KEGG   Vibrio parahaemolyticus RIMD 2210633: VPA0788Help
Entry
VPA0788           CDS       T00120                                 

Definition
outer membrane phospholipase A
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
vpa  Vibrio parahaemolyticus RIMD 2210633
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
Linoleic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vpa00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    VPA0788
   00565 Ether lipid metabolism
    VPA0788
   00590 Arachidonic acid metabolism
    VPA0788
   00591 Linoleic acid metabolism
    VPA0788
   00592 alpha-Linolenic acid metabolism
    VPA0788
Enzymes [BR:vpa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     VPA0788
    3.1.1.32  phospholipase A1
     VPA0788
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:815391..816329
Genome map
AA seq 312 aa AA seqDB search
MLETIKKSNGEETIESIRKQCELDTVTSTASVESTTKESEEPQESLIDKRLESEKQTAFE
PFSLVAHRINYILPFTYSDRVNKRAYADTKYGDELRKEEAEFQISFKVPMNYDDLLFDGD
GLFFGMTLKSFWQVYTGDASRPFRETNYRPELFYFTPTSWQPLGGSTWLGFGIEHESNGQ
RQELSRSWNRVYTNLTFAKDNFVASIQPWWRIPEDEKTFPNDPKGDDNPDIEDYMGHFEL
TSAYKWDDYELTFLGRENFKTHKGYAEIGLLFPIWGKVRGYAQYSTGYGKSLIDYDHNQQ
RIGVGIAINGVL
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
ttgctagaaacaatcaaaaaaagcaatggcgaagaaacgatcgagagcattcgcaagcag
tgtgagttagataccgtcacgagcactgcgtctgtcgaatcaacaacgaaagaatcagaa
gaaccgcaagaaagcttgatcgataaacgtttggagtcagaaaagcaaaccgcgttcgag
ccttttagcttggttgcacatcgaattaactacattcttccgtttacttatagtgaccgc
gtaaacaaacgtgcgtatgccgacaccaaatacggcgatgaactgcgtaaggaagaggca
gagtttcaaatcagctttaaagtaccaatgaactacgacgatttgttgtttgacggcgat
ggcctgttttttggtatgacgctcaaatcgttctggcaggtatacacgggggatgcgtcg
cgtccgtttcgcgaaaccaattatcgtcctgagctgttttacttcactcctacaagttgg
cagccgcttggtggctcaacttggctgggtttcggtattgagcatgaatcaaatggccaa
agacaagagctatcgcgcagttggaaccgcgtttataccaacttaacctttgcgaaagac
aattttgtcgcctctatccagccttggtggcgcatacctgaggacgaaaaaacctttccg
aatgatcctaaaggcgatgataacccagatatcgaagattacatggggcattttgagcta
acaagcgcctacaaatgggacgattacgagttgacgttcttggggcgcgagaattttaaa
acgcataaaggctatgctgagataggtttgttgtttccaatttggggaaaagttagggga
tatgctcaatactcgactggatacggcaagagtttaattgactacgaccataatcagcag
cgcattggtgttggtatcgcgatcaacggtgttctgtaa

DBGET integrated database retrieval system