KEGG   Vibrio parahaemolyticus RIMD 2210633: VPA0872Help
Entry
VPA0872           CDS       T00120                                 

Definition
arylesterase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
vpa  Vibrio parahaemolyticus RIMD 2210633
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:vpa00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    VPA0872
Enzymes [BR:vpa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     VPA0872
   3.1.2  Thioester hydrolases
    3.1.2.-  
     VPA0872
Lipid biosynthesis proteins [BR:vpa01004]
 Fatty acid synthase
  Component type
   VPA0872
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:complement(912953..913555)
Genome map
AA seq 200 aa AA seqDB search
MIRLLSLVLFFCLSAASQASEKLLVLGDSLSAGYQMPIEKSWPSLLPDALLEHGQDVTVI
NGSISGDTTGNGLARLPQLLDQHTPDLVLIELGANDGLRGFPPKVITSNLSKMISMIKDS
GANVVMMQIRVPPNYGKRYSDMFYDIYPKLAEHQQVQLMPFFLEHVITKPEWMMDDGLHP
KPEAQPWIAEFVAQELVKHL
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgattcgtttactttccttagttctctttttttgtctttccgccgcatcgcaagcaagc
gaaaagcttcttgttcttggtgatagcttgagtgctggctatcaaatgccgattgagaag
agttggcctagcttactccctgacgcgctgctcgaacacgggcaagatgtaacagttatt
aatggcagcatctccggagacactactggcaacggtttggctcgcctcccgcaactgctt
gaccaacatacacccgacttagttcttatcgagttgggcgccaatgatgggttgcgtggc
ttccctccaaaagttattacgtcgaatctgtcgaaaatgattagcatgatcaaagattct
ggtgccaatgtggtcatgatgcaaattcgtgtcccacctaactacggcaagcgctacagc
gacatgttttacgacatctatcctaaattggctgagcatcaacaagttcagttaatgccg
ttcttcttagagcatgtgatcaccaagccagagtggatgatggatgatggcttacatccg
aaacctgaagctcaaccttggattgcggaattcgttgctcaagaattggttaaacatctc
taa

DBGET integrated database retrieval system