KEGG   Vibrio parahaemolyticus RIMD 2210633: VPA1083Help
Entry
VPA1083           CDS       T00120                                 

Definition
(RefSeq) ribokinase
  KO
K00852  ribokinase [EC:2.7.1.15]
Organism
vpa  Vibrio parahaemolyticus RIMD 2210633
Pathway
vpa00030  Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:vpa00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    VPA1083
Enzymes [BR:vpa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     VPA1083
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin DUF498 Carb_kinase
Motif
Other DBs
NCBI-GeneID: 1191778
NCBI-ProteinID: NP_800593
UniProt: Q87H82
Position
II:complement(1142215..1143132)
Genome map
AA seq 305 aa AA seqDB search
MNKLVVLGSVNADHVLQVPSFPRPGETLHGRNYQVIPGGKGANQAVAAARLNADIGFIAC
VGDDSFGINIRENFKMDGIDIAGVKMQPNCPTGIAMIQVSDSGENSICISAEANAKLTSE
AIEPDLERIRQADYLLMQLETPMCGIEKAARVAKDAKTNVILNPAPARELSDELLACIDV
ITPNETEAEVLTGVTVTDNESAQEAANVLHGKGIEIVMITLGAKGVWLSQNGRGEIIPGF
RVEATDTTAAGDTFNGAFVTGLLEDLPLESAIKFAHAAAAISVTRFGAQTSIPTREEVDA
FLAEQ
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgaataagttagtggtgttaggtagtgtaaacgctgaccatgttcttcaagtgccttct
ttccctcgccctggcgagacgctgcatggtcgcaactatcaagttatcccaggtggcaaa
ggtgccaaccaagccgtcgcggcggcgcgattaaatgcagacattggttttattgcttgt
gtaggcgatgactctttcggcatcaacattcgtgaaaacttcaaaatggacggcatcgat
atcgctggtgttaagatgcaaccaaactgcccgacaggcatcgcgatgattcaagtgtcg
gacagtggtgaaaacagcatttgtatatcagcagaagcgaacgccaaactgacatcagaa
gcgattgagccagatttagaacgtattcgccaagcggattacttgctaatgcaattggaa
acgccgatgtgcggcattgagaaagccgcgcgtgtggcaaaagatgcaaaaaccaacgta
attttaaacccagctccagctcgcgaattgtcagatgaactgcttgcttgtattgacgtg
atcacgccaaatgaaacggaagctgaagtgctgacaggtgttactgtaacagacaacgaa
agcgcgcaagaagcggcgaatgtgctacatggtaaaggtattgaaattgtcatgatcact
ctcggtgcaaaaggcgtttggttgagccaaaatggtcgaggtgaaatcatccccggtttc
cgtgtcgaagcgaccgataccaccgcggcaggagatacgtttaatggggcattcgtcact
ggtctcttagaagatttacctttagaatcagcgattaagtttgcacatgcggcggctgca
atttctgtaacccgctttggcgcgcaaacgtcgatcccaactcgcgaagaggtggacgcg
tttctcgctgaacaataa

DBGET integrated database retrieval system