KEGG   Vibrio parahaemolyticus RIMD 2210633: VPA1101Help
Entry
VPA1101           CDS       T00120                                 

Definition
cytochrome c551 peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
vpa  Vibrio parahaemolyticus RIMD 2210633
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:complement(1161294..1162256)
Genome map
AA seq 320 aa AA seqDB search
MRLTTAIKWGAAVLFVCTASSVSVAKAEVELVLPIEGDPVVDVKLARIGWHLFRDPNLSS
NGKVSCESCHNLQTNGAQNTAVAAGVKGVGIRNAITVFNASLNYRLLWDGSSNTLVSQMD
GPIHDPLEMDSNWPKIESYVQNNEQYQALFKRAGNLPISIDNIKASIVEFVKGLETPGAP
FDAYLLGYTHVLNEKAKRGWKTFQKAGCVQCHQGKNVGGAMIQRFAYFEHKPVQKDTGRH
LLTTEGDEGYYFRVASLRNVALTGPYFHNGQVTTLAEAIQIMAQTQLGITMSDSNIEDIE
AFLTSLSAPRPVILEVLENE
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgaggctgactacagctatcaaatggggtgccgccgtgctattcgtttgtaccgcatca
tccgtcagtgttgcaaaagcagaagtcgaacttgttttgcctatcgagggcgatccggtc
gtcgacgttaagttagcgcggattggttggcatttatttagagatcccaacttgtcatcg
aatggtaaagtcagttgtgaaagttgccacaatctacaaacgaatggcgcgcaaaacaca
gccgtagcagcaggtgtaaaaggggtaggaatacgaaacgcgatcacggtttttaatgcg
tcactgaattaccgactgttatgggatggctcgtcgaatacgttagtctctcaaatggat
ggcccaattcacgacccgttagaaatggattccaactggccgaagattgaaagctacgtt
caaaacaacgagcagtatcaagcgctgtttaaacgcgctggaaacctgccaatttctatc
gacaacatcaaagcgtccattgttgagtttgtgaaagggcttgaaactccaggcgcgccg
tttgatgcctacttattgggttacacgcatgttttgaatgagaaagcgaaacgcggttgg
aaaaccttccagaaagctgggtgcgtacaatgtcatcaagggaaaaatgttggcggcgcg
atgattcaacgcttcgcttactttgagcataaacccgtgcagaaagacacaggtcgccat
ttactcacaacggaaggggatgaggggtattatttccgtgttgccagtttaagaaacgtc
gcattaacggggccgtattttcataacgggcaagtgaccacccttgctgaggccattcaa
atcatggcacaaacgcagcttggtattacgatgagtgatagcaatatcgaagacatcgaa
gcgttcttgacgtcactcagcgccccaaggccagtaattttagaggtgctggaaaatgaa
taa

DBGET integrated database retrieval system