KEGG   Vibrio parahaemolyticus RIMD 2210633: VPA1144Help
Entry
VPA1144           CDS       T00120                                 

Definition
hypothetical protein
Orthology
K08738  
cytochrome c
Organism
vpa  Vibrio parahaemolyticus RIMD 2210633
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:vpa00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    VPA1144
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    VPA1144
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:1207968..1208630
Genome map
AA seq 220 aa AA seqDB search
MRTKQPSERVLPLAFTLLALLSNPVLASNDELIAAGEKQAMVCKACHQFEPNGVTVVGPP
LWGLAERNIASFEGFNYSDGIRQHQGKWDAEKLDAFLSAPNDFAQGTNMVFPGVTDPGAR
AAIIAWLATKNPTPPNWNMTSSGLEVKSPGDGILTPGENMELVAAVCSACHSLHMVTQQG
LSRQRWDESLDWMIEEQGMEDLSGDDREAILEYLSTYYGG
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
gtgagaacaaaacaaccatcagagcgggtactcccgctcgctttcacccttttggctttg
ttgagcaaccctgtccttgcgagtaacgacgagttgattgcagcaggcgagaagcaagcc
atggtttgtaaagcctgccatcagtttgagccgaatggcgtaacggtggttggcccgccc
ttatgggggctagcagagcgcaatatcgccagttttgagggcttcaattacagcgacgga
attagacaacatcaaggaaagtgggacgctgaaaagttggacgcatttttatccgctccg
aatgacttcgcgcaaggaaccaacatggtctttcctggcgtaacagatcccggtgcgcgc
gcggctatcattgcatggcttgcgacgaaaaacccgacaccacccaattggaatatgacg
tcatcaggattggaggttaaatcgccaggtgatgggatattaacgccgggagagaatatg
gagctcgtcgctgcagtctgctcagcctgtcattcgttacacatggtcacacaacaagga
ctaagccgccaaagatgggatgaaagcctcgactggatgattgaggagcaaggaatggaa
gatttatcaggcgacgaccgagaagccattctggaatacctttctacctattatgggggg
taa

DBGET integrated database retrieval system