KEGG   Vibrio parahaemolyticus RIMD 2210633: VPA1169Help
Entry
VPA1169           CDS       T00120                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
vpa  Vibrio parahaemolyticus RIMD 2210633
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:vpa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    VPA1169 (folE)
Enzymes [BR:vpa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     VPA1169 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:complement(1235907..1236560)
Genome map
AA seq 217 aa AA seqDB search
MSGLSESAKLVKEALEQRGLETPMRPNAVSREEKKEKIEHHMREILTLLQLDLTDDSLEE
TPHRIAKMYVDEIFSGLDYSNFPKITVIENKMNVSEMVRVKDITVTSTCEHHLVTIDGKA
AVAYIPRGKIIGLSKINRIVRFFAQRPQVQERMTQQILVALQTLLESDDVAVTIDATHYC
VKSRGVMDATSETTTTALGGIFKSNPATRAEFLHGLR
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggtcttagcgagtcagcgaagttagtaaaagaagcgctagagcaacgcggttta
gaaacaccaatgcgtcctaatgccgtgagccgtgaagagaagaaagaaaagatcgagcac
cacatgcgtgagatcctaaccctgcttcaactcgaccttacggatgacagcctagaagag
acgccacatcgcattgcaaaaatgtacgtggacgagattttctctggtttggattactcc
aacttcccaaaaatcacggttattgaaaacaagatgaacgtaagtgaaatggttcgcgtg
aaagacatcaccgtaaccagcacgtgtgaacaccatcttgtcacgatcgacggcaaagcg
gccgttgcgtatattcctcgtggtaaaatcattggtctctctaagatcaaccgcattgtc
cgtttcttcgcgcaacgtcctcaagttcaagagcgtatgacacagcaaatcctagttgct
ttgcaaacattgcttgagtctgacgatgtggccgtgactatcgacgcgacgcactactgc
gtgaaatcacgtggtgttatggatgcaaccagcgaaacgacaaccacagctttaggtggt
atttttaagagcaacccagccactcgcgctgagtttctgcatggtttacgctag

DBGET integrated database retrieval system