KEGG   Vibrio parahaemolyticus RIMD 2210633: VPA1251Help
Entry
VPA1251           CDS       T00120                                 

Definition
ABC transporter
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
vpa  Vibrio parahaemolyticus RIMD 2210633
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:vpa00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    VPA1251
  Metabolism of other amino acids
   00480 Glutathione metabolism
    VPA1251
Enzymes [BR:vpa01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     VPA1251
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:1324650..1325195
Genome map
AA seq 181 aa AA seqDB search
MKGLLKLAAYLGFISMSSFVLASECPDILQGKQRMLNSTEEIELCEVFKGKTLLVVNTAS
QCGFTPQYEQLETLYQTYKDKNFAVIGFPSNDFRQDKGSEENTAKICYLDYGVTFPMMAR
SSVLGNDANPVFSEISTQAGVTPKWNFYKFLISKEGKVIATFPSSTSPTSTTLTNMIEQQ
L
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggattactgaaactcgccgcgtaccttggctttatctccatgagttcgtttgtt
cttgcgtctgagtgccccgacattctgcaaggcaaacagcgaatgttaaattcaacagaa
gaaattgagctttgtgaagtattcaaagggaaaacattgctcgtcgtaaacactgccagc
caatgcggttttacacctcaatatgagcaactagaaacgctataccaaacttacaaagat
aaaaacttcgcagtcatcggttttcccagtaacgattttcgacaagacaaaggaagcgaa
gaaaataccgcaaagatctgctatctcgactacggcgtgacgtttcctatgatggctcga
agctctgtattgggcaacgatgccaaccctgtcttttctgaaatcagcactcaagccggt
gtgacaccgaagtggaacttttacaagtttctcatcagtaaagaaggcaaagtcatcgcc
acatttccaagctcaacctctccgacgagtactacgcttactaatatgattgagcaacaa
ctgtag

DBGET integrated database retrieval system