KEGG   Vibrio parahaemolyticus RIMD 2210633: VPA1266Help
Entry
VPA1266           CDS       T00120                                 

Definition
ATP-dependent exoDNAse subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
vpa  Vibrio parahaemolyticus RIMD 2210633
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:vpa03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:complement(1345376..1347403)
Genome map
AA seq 675 aa AA seqDB search
MNTALHEDQMRVTSIPYRSTKMVIFSGVPLAKDSYKTNSGKYYVTIKADPDSIPVLPTLG
QHWSVKGARQIESVEMGDYVMQQHTYESPKHIECTLPETGEQLIRFIARESDFKGIGESK
ARALWQLLGKDFHTTLRNDTLESRKRLTSILSEDSVEALFKGYAKYKNLAHCNWMSEHNI
PASVQQRLLKHHGEASIEVIKDNPYALMGFGLSFSAIEDIIKVTDFKSDVAKDDPRRLSA
ALEMAIRKEIEKGHTYTTHANVRHYLSKLLKDKTLVTQAFQSGHDKAQYILNPDTGAYHP
TAQLLMESVVAKRLNTLIKRNDLFDENANAAYCAAVTELPYELTLKQIEAVTTCLDNSVS
CITGGAGTGKTTVLRTTLRAYHQLGFEIHAVALSGRAAMRLHESIGFVTSTIAKLLREDP
IEPSVEKTNHLLVIDEASMIDLPTMYRLVNHIHPSVRLIFTGDPDQLPPIGCGKVLADIV
EAKTVANTMLDIVKRQEGSTGIPEYSKLINQGVMPDQLSTGAIHFHETNKADIAKVCCEL
YQQCPENSRVMAPTKAIVTEINKLTQQAVNPNSDRLEFEINGDKFFLPLRMNDAVLFTQN
HYDKGIQNGSLGMLTNAKTSGDSYGEVTLDTGEKVEITQSVLDCMELGYAITLHKAQGSQ
FPRIIIALQKGRIVD
NT seq 2028 nt NT seq  +upstreamnt  +downstreamnt
atgaataccgctttgcatgaagaccaaatgcgtgtcaccagtatcccttatcgctcgacc
aagatggtgatattcagcggtgtaccgctggcgaaggactcttacaaaaccaatagtggg
aagtattacgtcaccatcaaagccgaccccgatagcatccctgtgcttccaacgctgggt
cagcattggtcagtcaaaggcgctcgccagatagaaagtgtggagatgggtgattatgta
atgcagcagcacacgtatgaatcacccaagcatattgaatgcactttacccgaaacaggt
gagcaactgatacgctttatcgccagagaaagtgacttcaagggtattggtgaaagcaaa
gctagggcgctctggcagctcttgggtaaagacttccataccacactgagaaatgacacc
ctagagtccagaaagcgtctgacatcgattctgagtgaagattcagtggaagcgctcttt
aaggggtacgccaaatataaaaatctggcacattgcaactggatgagtgagcacaacatc
cccgccagtgtgcagcaacggctgctcaagcatcacggtgaagcctccatagaggtaatt
aaggataatccttatgctttgatgggctttggtctttcgttcagtgccattgaagatatt
atcaaggttacagattttaagagcgatgttgcgaaggatgatccaagaaggctcagcgct
gctctggaaatggcgatacgaaaagagattgaaaaaggtcacacctacaccactcatgcc
aatgtgcgccattacctcagcaagctactgaaagacaaaacactggtcactcaggcgttc
caatcaggtcatgataaagcccagtacattttaaaccccgacacaggagcctaccatcca
actgcgcaacttctgatggaaagtgtcgttgccaagcggctaaatacactgattaagcga
aatgacttgtttgatgaaaacgccaatgctgcgtattgcgctgcggttacggagcttccc
tacgaattaaccctaaaacaaatcgaagccgtcacaacgtgtctggataattcggtaagc
tgcattacgggcggtgcaggaacaggcaagacaacggtactcagaacgactctcagggct
taccatcaactcggatttgaaatacacgccgtggcgctcagtggtcgcgctgcaatgagg
cttcatgagtccatcggttttgtcacctcaaccattgctaaactgctgcgtgaagaccct
attgaacccagtgtcgagaaaacaaatcacctactggtgattgatgaggcaagcatgatt
gacttgccaaccatgtatcgtcttgtgaatcacattcacccctctgtacgattgatattc
actggcgaccccgaccaacttccaccaatcggctgcggcaaggtactggcagatatcgtt
gaggcaaaaacggtggctaatacgatgctggatatcgtcaagagacaggaaggctcaacg
ggtatccctgaatactcaaagctcatcaaccaaggtgtgatgcctgaccaattaagcacg
ggtgcaatacactttcacgaaaccaacaaagcagacattgccaaagtctgttgtgagctt
taccaacagtgtcctgaaaacagtcgtgtcatggctccaaccaaggcgatcgtaacagaa
atcaataaactcacccagcaagcggtcaacccaaacagtgacagacttgagtttgaaatc
aatggtgataagttctttttgccccttcgcatgaatgatgcggtgttatttacccagaat
cattacgacaaaggtattcagaatggctcacttggtatgctaaccaacgccaaaacttct
ggtgatagttacggtgaagtgacgctagatacaggcgaaaaggtcgagataacacaatcc
gttctcgactgcatggagttgggttacgcaatcaccctacataaagctcaagggtcacag
tttccgcgcatcatcattgccctgcaaaaaggaaggatagtagattga

DBGET integrated database retrieval system