KEGG   Vibrio parahaemolyticus RIMD 2210633: VPA1618Help
Entry
VPA1618           CDS       T00120                                 

Definition
glycogen branching enzyme (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
vpa  Vibrio parahaemolyticus RIMD 2210633
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:vpa00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:complement(1717200..1719467)
Genome map
AA seq 755 aa AA seqDB search
MSSQRWLWRNQHSVQTNIGSREKDLKITKTKKIKKKHERAYELLAEAAYSDPFAALGPFI
DDGEGSLRVWMPGANKVELLVNGEPRVALERDGDSGFILKEQRDLHLTHYRLAVDWNGVE
QIIDDPYQYHNIYQEYEHLHTPKDMYHYMGAHFVTLERGGENISGVRFLVYAPHASAVSL
VGCFNQWDGRRHPMQRLDYGIWGLFIPGLEEGVQYKFELKGPNGEGLPHKQDPWGFYSEQ
YPSFASITYDHKRYQWQDAKWQNRAVTQKRDEALSFYELHAGSWKRDGKGDFLNYRELAE
QLVPYLVDMGYTHVELMPVSEHPFYGSWGYQPVGLFAPTSRYGSPDDFKFFVDACHQAGI
GVVLDWVPAHFPSDDHGLANFDGTPLFHDPDPRRGWHQDWNSYIYDLGREHVRRFLVSNA
LYWFEQFHIDGIRVDAVASMLYLDYSRSHDQWVPNVDGGNENYDAIATLKWMNEEVYKHF
PNAMTIAEESTAFPGVSAPTFMGGLGFGFKWNMGWMHDSLSYVKEDPVHRKYHHNTITFP
LVYAHSENYVLSLSHDEVVYGKGSIHNKMPGDEWQQTANLRAYYGYMYGQPGKKLNFMGA
EIGQTAEWNHDDQLQWFLLEYERHQGVQKLMRDLNHLYRNEAAMHDQDCVPAGFEWRLQD
EADASILAHERISKEGERILIITNFTPVPHERFRLGVPNVGQYELLLNTDDSKYGGSDFK
VLTSVKTEKVESESLPQSLELRLPPLSTVFYKLHK
NT seq 2268 nt NT seq  +upstreamnt  +downstreamnt
gtgagttcacaacgttggctgtggagaaaccaacattcggttcaaacgaatattggctct
agggagaaagatttgaaaatcaccaaaacaaagaaaataaagaaaaaacacgaacgcgcg
tacgaactgcttgctgaggcggcttactcagatccatttgcggcgttgggcccattcatt
gatgacggcgaaggttcgctgcgagtgtggatgccgggcgcaaacaaggttgaactgctt
gttaatggtgaacctcgcgtggcgcttgaacgcgatggcgacagcggttttatcttaaaa
gagcaacgcgatttacacctgacccactaccgtttagcggtcgattggaatggtgttgaa
caaattattgatgacccgtaccagtaccacaatatctaccaagagtacgagcatctgcat
acgccaaaagacatgtatcactacatgggcgcgcactttgtcacgctagaacgtggcggt
gaaaacatttccggtgttcgtttccttgtctacgctccgcatgcatcggctgttagcctt
gtgggttgcttcaaccaatgggatggtcgtcgtcacccaatgcaacgtttagattatggc
atttggggtttgttcattcctggcttagaagaaggcgttcagtacaaatttgagctcaaa
gggccaaatggggaagggctaccacacaaacaagatccttggggtttctactctgagcaa
tacccatcgttcgcatccattacttacgatcacaagcgttaccaatggcaagatgcgaaa
tggcaaaaccgcgcagtgacacaaaagcgtgatgaagcgttatcgttttatgagctacat
gctggatcatggaagcgcgacgggaaaggtgatttcctcaactaccgcgaactcgcggag
cagttggtgccataccttgtggatatgggctacacccatgttgagctgatgcctgtgtct
gagcatccattctatggttcatggggctatcaacccgttggcttatttgcgccaactagc
cgttacggctctcctgatgatttcaaattcttcgtggatgcgtgtcaccaagctggtatc
ggtgtggtgctggattgggttccggcgcatttcccatcggatgaccacggtttagcaaac
tttgacggcacaccgctgttccacgacccggacccacgtcgcggttggcaccaagattgg
aactcatacatctatgatttaggccgtgaacatgtgcgtcgcttccttgtatcgaatgcg
ctgtactggtttgaacaattccatattgatggtattcgcgtggacgcagtcgcatcgatg
ctctatctcgattattcacgtagccacgatcagtgggtaccaaacgtcgacggtggtaac
gaaaactacgacgccatcgcaaccttaaaatggatgaacgaagaagtgtacaagcacttc
ccgaatgcgatgacgatagcggaagagtcaacggcgtttccgggggtgtctgcgccaacc
tttatgggtggtttaggctttggcttcaagtggaatatggggtggatgcacgacagtctt
tcatacgtcaaagaagatcctgttcaccgcaaataccaccacaataccatcacattccca
ctggtttatgcgcacagcgagaactacgtcttgtctctctctcacgatgaggtggtgtac
ggcaaaggctctatccataacaagatgccgggtgatgaatggcagcaaactgcaaaccta
cgtgcatactacggttacatgtatggtcaaccgggcaaaaagctgaacttcatgggcgcg
gaaatcggccaaacggcggagtggaaccacgatgatcagttgcaatggttcttgctggaa
tatgagcgtcatcaaggcgtgcaaaagctgatgcgcgatttgaaccacttgtaccgaaat
gaagcggcgatgcacgatcaagattgtgtccctgcgggttttgagtggcgtctacaagac
gaagcggatgcgagtatcctagcgcacgagcgtatcagtaaagaaggtgagcgtattctc
atcatcaccaactttacgcccgtaccacacgagcgttttcgtttaggcgttccaaatgta
ggtcaatacgaactgctgctgaacacggatgacagcaaatacggcggcagcgattttaaa
gtgctgaccagtgtgaaaacggaaaaagtcgaaagtgaatcactgccacaatcacttgag
cttcgtttaccaccactttcaaccgtgttctacaagctgcacaaataa

DBGET integrated database retrieval system