KEGG   Vibrio parahaemolyticus BB22OP: VPBB_0029Help
Entry
VPBB_0029         CDS       T02409                                 

Definition
3-hydroxyacyl-CoA dehydrogenase
Orthology
K01825  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
vpb  Vibrio parahaemolyticus BB22OP
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:vpb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    VPBB_0029
   01212 Fatty acid metabolism
    VPBB_0029
  Carbohydrate metabolism
   00640 Propanoate metabolism
    VPBB_0029
   00650 Butanoate metabolism
    VPBB_0029
  Lipid metabolism
   00071 Fatty acid degradation
    VPBB_0029
   01040 Biosynthesis of unsaturated fatty acids
    VPBB_0029
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    VPBB_0029
   00310 Lysine degradation
    VPBB_0029
   00380 Tryptophan metabolism
    VPBB_0029
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    VPBB_0029
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    VPBB_0029
   00281 Geraniol degradation
    VPBB_0029
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    VPBB_0029
Enzymes [BR:vpb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     VPBB_0029
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     VPBB_0029
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     VPBB_0029
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  dodecenoyl-CoA isomerase
     VPBB_0029
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(28066..30237)
Genome map
AA seq 723 aa AA seqDB search
MIYQADTLQVKEIQDGIAELSFCSPKSVNKLDLATLESLDKALDALTSHQGLKGLMLTSD
KDAFIVGADITEFLGLFAKTDAELDQWLQFANSIFNKLEDLPVPTISVLKGHTLGGGCEC
VLATDMRIGDKTTSIGLPETKLGIMPGFGGCVRLPRVIGADSAMEIITQGKACRADEALK
IGLLDAVVETDALYESALQTLTSAINEKIDWQARRKQKTSPLTLSKLESMMSFTMAKGLV
AQKAGPHYPAPMTAVITIEEGARFARNEALDIERKYFVKLAKSEEAKALVGLFLNDQHIK
GIAKKAAKSASKNTERAAVLGAGIMGGGIAYQSALKGVPVLMKDIAQPSLDLGMTEASKL
LNKRLAQGRIDGFKMAGILASITPSLHYAGIENSDVIVEAVVENPKVKAAVLSEVESHAG
EDTVITSNTSTIPINLLAQSLKRPENFCGMHFFNPVHRMPLVEIIRGEKTSDETINRVVA
YAAKMGKSPIVVNDCPGFFVNRVLFPYFGGFSMLLRDGADFTKVDKVMERKFGWPMGPAY
LLDVVGIDTAHHAQAVMAEGFPERMGKQGRDAIDALFEANKYGQKNGNGFYSYTIDKKGK
PKKTFTEDILPVLADVCADKQEFDEQTIIQRMMIPMINEVVLCLQEGIIATPQEADMALV
YGLGFPPFRGGVFRYLDSVGIAEFVEMAKQHADLGAMYHVPQMLIDMAAKGESFYGAQQQ
GSI
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atgatttaccaagccgacaccctacaggtaaaggaaatacaagatggcatagcagagctg
agcttctgctcccctaaatccgtaaacaagctcgacctagcaacgctagagtctctcgat
aaggctcttgatgcgttgacttcacatcaaggtctaaagggcttaatgctcacttcagat
aaagatgcgttcatcgttggcgcagacatcactgaattcttgggcctcttcgctaaaaca
gacgccgagctcgatcaatggctacaatttgccaatagcattttcaataaactagaagac
ttacccgttccgacaatctcagtacttaaaggtcacacacttggcggcggctgtgaatgc
gtactggctaccgacatgcgcatcggtgacaagaccaccagcattggcctaccagaaacc
aaactgggcatcatgccaggctttggtggttgtgtgcgtttgccgcgcgttatcggtgca
gatagcgcgatggaaatcatcacgcaaggcaaagcatgtcgtgcagatgaggccttgaag
attggtttattggatgccgtggttgaaactgatgcgttgtatgaatccgcattgcaaaca
ctgacttcagctatcaacgaaaagatcgattggcaagcacgtcgtaaacaaaaaacctcg
ccactgacactcagcaagctagagtcgatgatgagcttcacgatggcaaaaggcctagtg
gcacaaaaagcaggtccacactaccctgcgccaatgactgcagttattacgattgaagaa
ggcgcacgctttgcgcgtaacgaagcactcgacattgaacgcaaatacttcgttaaactc
gcgaaatcagaagaagccaaagctctggttggtctgttcctcaacgaccaacacatcaaa
ggcatcgcgaaaaaagcggcgaaatcagcaagcaaaaacactgagcgagcagcggtatta
ggtgcaggcatcatgggtggtggcattgcttaccaatctgcgctgaaaggcgtgccagta
ttgatgaaagacatcgcccaaccatctctcgatttaggcatgaccgaagcgtctaaactg
ctaaacaaacgccttgctcaaggtcgtatcgacggcttcaagatggcgggaattttggca
tcaattaccccaagcctacattacgcaggcatcgaaaactcagatgtgattgttgaagcc
gttgtcgaaaatccaaaagtaaaagcagcggtactgagcgaagtcgaatcgcacgctggt
gaagacaccgtcattacatcaaacacatcgacgattccaatcaacctattggcacaatca
cttaaacgcccagaaaatttctgtggtatgcacttctttaaccctgtgcatcgcatgcct
ttggttgaaatcatccgtggtgagaaaacttctgatgaaaccatcaaccgcgtagtggct
tacgcagcgaaaatgggtaaatccccaatcgtcgtgaacgactgtccgggattcttcgtc
aaccgcgtattattcccgtactttggcggtttcagcatgttgcttcgtgacggtgcagac
ttcactaaagtcgacaaagtcatggaacgcaaatttggctggccgatgggcccggcgtac
ttgcttgatgtagtcggcatcgatactgcgcaccacgcacaagcggtgatggcagaaggt
ttccctgagcgaatgggaaaacaaggtcgtgacgcgattgatgctctattcgaagccaac
aaatacggtcagaagaatggcaacggtttctacagctacaccattgataaaaaaggtaag
cctaagaaaaccttcactgaagatatcttgccagtactggcagacgtctgcgcggataaa
caagagttcgatgagcaaaccatcatccaacgtatgatgattccgatgatcaacgaagtg
gtgctgtgtctgcaagaaggcattattgcaactcctcaagaagcagatatggcgctggtt
tacggccttggtttccctccattccgcggcggtgtattccgctacctagacagcgtaggt
attgctgaatttgttgaaatggcaaaacagcacgctgatctaggcgcgatgtaccatgtt
ccgcaaatgttgattgatatggcggcgaaaggcgaaagcttctacggcgcgcaacagcaa
ggctctatctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system