KEGG   Vibrio parahaemolyticus BB22OP: VPBB_0196Help
Entry
VPBB_0196         CDS       T02409                                 

Definition
Formamidopyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
vpb  Vibrio parahaemolyticus BB22OP
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:vpb03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:214870..215679
Genome map
AA seq 269 aa AA seqDB search
MPELPEVEVSRMGISPHMVGQTIKAFVFRTPKLRWDIPQELKLLEGQVIRAIHRRAKYLL
IETDAGTAIVHLGMSGSLRVLDADFPAAKHDHVDLKLTNGKVLRYNDPRRFGAWLWCAPG
ESHAVLDHMGPEPLTDAFNSEYIADKAQGKRVAVKQFIMDNKVVVGVGNIYANESLFKTR
IHPTRPAGKLTKKEWRLLVENIKATLEIAIQQGGTTLKDFAQADGKPGYFAQELLVYGKA
REPCPECGKALQEQKIGQRNTFFCNVCQQ
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaattaccagaagttgaagtaagccggatgggtattagtccacatatggttgga
caaacgattaaggcatttgtttttcgcacgcccaaactgcgctgggatatcccgcaagag
ctgaaattgcttgaagggcaagtgattcgagccattcatcgtcgcgcaaagtatttgctc
atagaaacggatgcaggaactgctattgtgcaccttggaatgtcaggctcgttacgtgtg
ttggatgctgattttcctgcggctaagcacgatcatgtcgatctcaaacttacaaatggt
aaagtgctgcgttataacgaccctcgacgctttggtgcttggctatggtgcgcacctggt
gagtcccatgcggtacttgatcatatggggccagagcctctaactgatgcgtttaatagc
gagtacattgctgataaagcgcaaggtaagcgtgttgcggttaaacagttcattatggac
aataaagtggtggttggcgttgggaatatctacgccaatgagtctttgtttaaaacccgc
attcacccaactcgcccagcaggaaaactaactaagaaagagtggcgattactggtggag
aacatcaaagccacgttagaaatcgcgattcagcaaggtggaactacacttaaagacttc
gctcaagcagacggcaaacctggttactttgcacaagagttattagtttacggaaaagcc
agagagccatgtccagaatgcggtaaagctctccaagagcagaaaatagggcaacgtaat
accttcttttgcaatgtgtgtcagcagtag

DBGET integrated database retrieval system