KEGG   Vibrio parahaemolyticus BB22OP: VPBB_0342Help
Entry
VPBB_0342         CDS       T02409                                 

Definition
Dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
vpb  Vibrio parahaemolyticus BB22OP
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:vpb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    VPBB_0342
   00670 One carbon pool by folate
    VPBB_0342
Enzymes [BR:vpb01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     VPBB_0342
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:346048..346530
Genome map
AA seq 160 aa AA seqDB search
MIISMIAAMADNRVIGKDNQMPWHLPADFAWFKRCTMGKPVVMGRKTYDSIGRPLPGRLN
IVISRDESLSIEGVTTVTSVEKALEAAGDVEEVMIIGGGAIYASCLAMANKLYVTHIDAV
VEGDTQFPDWGNEFKETYSETYQADEKNAYNMRFTILEKQ
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgatcattagtatgattgcagcgatggcagacaaccgcgttattggcaaagataatcaa
atgccttggcatcttcctgcggattttgcttggtttaaacgttgtacgatggggaagccc
gtcgtaatgggaagaaagacttacgattcaattggtcgccctttgccaggacgtttgaat
attgtcattagccgagatgaatcattgagtattgaaggcgttacgacggtgacttcagtt
gaaaaagcgttagaggccgcaggtgatgttgaagaagtaatgatcattggtggcggtgct
atctatgcttcttgtttagcgatggcaaataaactgtacgtcacacatattgatgctgta
gttgaaggtgacacccagttcccagactggggtaatgaattcaaagagacatattctgaa
acctaccaagcggatgagaaaaacgcttacaacatgcgttttactattttagaaaagcaa
tag

DBGET integrated database retrieval system