KEGG   Vibrio parahaemolyticus BB22OP: VPBB_0435Help
Entry
VPBB_0435         CDS       T02409                                 

Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
vpb  Vibrio parahaemolyticus BB22OP
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:vpb00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    VPBB_0435
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    VPBB_0435
Enzymes [BR:vpb01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     VPBB_0435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:452041..453522
Genome map
AA seq 493 aa AA seqDB search
MTKAISMDALLSPWVDCPSLASVLVSELELDSRKVQPGTTFVAIVGHVVDGRKFIASAIE
KGANAVIAQACDVKAHGTIDIIDDIPVVYLDALDKCLSEIAGQLYTYPDMKLIGVTGTNG
KTTITQLIAQWIGLVGSKAAVMGTTGNGFLDDLKEAANTTGNAVEIQHTLASLAEQQAQY
TALEVSSHGLIQGRVKSLSFAAGVFTNLSRDHLDYHGTMEEYANAKLTLFTQHQCDQAII
NVDDEVGAAWAKQLTNAIAVSLAPTTEFEHALWASQVAYAESGITIRFDGQFGEGTLHAP
LIGEFNAANLMLAFATLLNLGFDKNDLLATAAQLQPVLGRMELFQAEHRAKVVVDYAHTP
DALEKALQALRVHCDGQLWAIFGCGGDRDAGKRPMMAEIAERLGDKVVLTDDNPRSEDPV
FIVKDMLAGLSKPAEAIVQHDRFKALSYALENAAPQDIILLAGKGHEDYQIRNGETIHYS
DRESAMQLLGLSS
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgactaaagccatcagtatggacgcgctgctttccccttgggtggattgccctagtttg
gcgtccgttctcgtttcagaactagaacttgatagtcgcaaagttcaaccaggtacaact
tttgtcgctattgtcggccatgtggtagatggacgtaagttcattgcctctgcgattgaa
aaaggcgccaatgcagtgattgcccaggcttgtgatgtgaaagcgcatggcacaatcgac
atcatcgatgatattccggtggtttatctcgatgcgcttgataaatgtttatctgaaatt
gccggccagttgtacacctatcctgatatgaagttgattggtgtgacaggcacaaacggt
aaaaccaccatcacccagcttatcgcgcagtggattgggttagttggttcaaaagcagca
gtgatgggcaccacaggtaatggtttcttagatgatttaaaagaagcggcgaacaccaca
ggaaacgcggtggaaatccagcatacgctggcttctttggccgaacaacaagcgcaatat
acggcgttagaagtgtcttctcatggcttgatccaaggccgcgttaaatccctttccttt
gctgctggcgtatttaccaacttgagccgagaccatcttgattatcacggtacgatggaa
gagtacgccaacgccaaactaacgctgtttacccagcatcaatgtgatcaagcaatcatc
aatgttgatgacgaagttggcgctgcgtgggcgaaacaactgaccaatgcgattgccgtt
tctcttgctcctacaactgagtttgaacacgcgctatgggcgagccaagtggcttatgct
gaatctggtattacgattcgttttgatggtcagtttggcgaaggtacgctgcatgcgccg
ttgattggtgaattcaacgcagccaacttaatgctggcatttgcgaccttattgaacctt
ggttttgataagaacgatttgctagcgacggctgctcaattgcagccggtgttaggccga
atggagctattccaagctgagcatcgcgccaaagttgtggtcgattacgctcacacgcct
gatgcgcttgaaaaagcattacaagcactgcgcgtgcattgtgacggacagctttgggct
attttcggttgtggtggcgatcgcgatgcgggtaagcgtccgatgatggcagaaatcgct
gagcgtttgggtgacaaagtcgtcttgaccgatgataacccacgcagtgaagaccctgta
ttcatcgtcaaagatatgcttgctggcctatccaaaccagcagaagcgattgtccagcat
gatcgctttaaagcgctttcttacgcgttagaaaacgctgcgcctcaagacattatcttg
ctggcaggtaagggccacgaagactaccaaattcgtaacggcgaaacgattcattattcc
gaccgcgaatccgcaatgcagcttttaggattgtcctcatga

DBGET integrated database retrieval system