KEGG   Vibrio parahaemolyticus BB22OP: VPBB_0474Help
Entry
VPBB_0474         CDS       T02409                                 

Definition
(RefSeq) Threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
vpb  Vibrio parahaemolyticus BB22OP
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:vpb00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    VPBB_0474
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    VPBB_0474
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    VPBB_0474
Enzymes [BR:vpb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     VPBB_0474
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
1:508298..509578
Genome map
AA seq 426 aa AA seqDB search
MKLYNIKENDEQVSFGQAVRQGLGRNQGLFFPSELPKFEDVDALLAEDFVSRSTKILSAL
IGDELAEEQVNAMVDAAFQFPAPINQVKEGVYALELFHGPTLAFKDFGGRFMAQSLAAVS
NGGKITILTATSGDTGAAVAHAFYGMEDINVVILYPKGKISPLQEKLFCTLGKNIHTVAI
NGDFDACQALVKQAFDDAELREEIGLNSANSINISRLMAQICYYFEAAAQMSKQERENLV
VSVPSGNFGNLTAGLLAKALGLPIKRFIAATNANDTVPRYLETGKWEPKPTVATTSNAMD
VSQPNNWPRIEELCRVKEWGLETLGKGAVSDEQSAQSVKDLYALGYLCEPHGAIAYRVLE
EQLQEGETGLFLCTAHPAKFKEVVDDILQTDIELPAPLAKHAAMELLSEDLDADFDALKT
VLRRVQ
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgaagctttacaatataaaagaaaatgatgaacaagtttcctttggccaagccgttcgc
caaggattaggtcgtaatcaaggcctattttttccatcggaattaccaaaatttgaagac
gttgatgcgttgctagcagaagattttgtttctcgtagcactaagatcctatcagcactg
attggtgatgaactggcggaagagcaagttaacgcaatggttgatgcagcattccaattc
ccagcaccaatcaaccaagtaaaagaaggcgtttacgcgctagaacttttccatggcccg
acgttagcatttaaagatttcggtggccgcttcatggcgcaatcccttgcggcagtttct
aatggcggcaagatcaccattttgaccgcaacgtcaggcgatactggcgcggctgttgca
catgctttctacggaatggaagacattaatgttgtgattctttacccgaaaggcaagatc
agtccgctccaagagaagctgttttgtacactaggtaaaaacatccacactgtagcaatc
aatggcgatttcgatgcatgtcaagcattggtgaaacaagcgtttgatgatgcggagctg
cgtgaagagatcggtctgaactctgcaaactcaatcaacatcagccgcttgatggcacaa
atctgttactactttgaagctgcggcgcaaatgagtaagcaagagcgtgaaaacctcgtg
gtttctgtaccaagcggtaactttggtaacctaacagcaggtctattagcaaaagcgcta
ggtttacctatcaaacgttttattgctgctaccaacgcgaatgacacggtgcctcgttac
ctcgaaacgggcaaatgggagccaaaaccaacggttgcaaccacttcaaatgcgatggac
gtgagccaaccgaacaactggccgcgtatcgaagagctgtgccgtgtgaaagagtggggt
ctagagacactaggtaaaggcgcagtttctgatgagcaaagcgcacaatcagtaaaagac
ttgtacgcattaggctacctatgtgagccacacggtgcgattgcttaccgcgtattggaa
gagcaactgcaagaaggtgaaacgggtctgttcttgtgtactgcgcacccagcgaagttc
aaagaggttgtagatgatattcttcagacggatatcgaactgcctgcaccactagctaaa
catgctgcgatggagttgttgtctgaagatcttgacgcggattttgatgcactaaaaaca
gtattacgccgcgttcagtaa

DBGET integrated database retrieval system