KEGG   Vibrio parahaemolyticus BB22OP: VPBB_0487Help
Entry
VPBB_0487         CDS       T02409                                 

Definition
Thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
vpb  Vibrio parahaemolyticus BB22OP
Brite
Enzymes [BR:vpb01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     VPBB_0487
Secretion system [BR:vpb02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   VPBB_0487
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:521903..522751
Genome map
AA seq 282 aa AA seqDB search
MMACFILLDWMKRIYLKVTLMSVLRRLTLLTLPFFITACGAEESQAKTETPAQQAAPTAQ
QHFDEAALKAKFSKLGLSIIDIQPSDVAGLLEIQTNGGILFASNNGDHFIAGTLYAIDDN
GGYKDVLAERQAPLNAEKIAKFADSMIEYKADNEKYVVTVFTDITCGYCVRLHNQMQGYN
DLGITVRYMAYPRQGATGPVAEQMATIWCAEDPKAAMHNAKVSRTFDNPAKDLEQCKETI
QAHYNVGRQLGISGTPAIFLPNGEMVGGYLPPAELLKRLEQL
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgatggcttgcttcatccttcttgattggatgaaaagaatttatttaaaggtgacttta
atgagcgtattacgccgactaactctgctgactttaccattctttattaccgcgtgtggt
gcggaagaaagtcaggcaaaaaccgaaactcctgcacaacaggctgcgccaactgcgcaa
caacactttgatgaagcggcgttaaaagcgaagttctcgaaactaggtctgtctattatt
gatattcaaccttcagacgtggcgggcttgctagaaattcaaaccaatggcggcatattg
tttgcgtcaaacaatggcgatcactttattgcaggtacgctatacgcgattgatgacaac
ggcggttacaaagacgtacttgcagaacgccaagcgcctttgaatgctgagaaaattgct
aagtttgcagacagcatgatcgaatacaaagcggacaacgaaaagtacgtggtgactgtg
tttactgacatcacttgtggctactgtgttcgtctgcataaccaaatgcagggctacaat
gatctaggtattactgtgcgttacatggcataccctcgccaaggtgcgacagggcctgtt
gctgagcaaatggcaacgatttggtgtgcagaagatccaaaagcggcgatgcataacgcg
aaagtgagccgcactttcgacaatccagcgaaagatcttgaacaatgtaaagagaccatc
caagcgcactacaacgttggtcgtcagttaggtatttcaggtacacctgcaatcttcctt
ccaaacggtgagatggttggtggttacttaccgccagctgaactactgaaacgtttagag
caactgtaa

DBGET integrated database retrieval system