KEGG   Vibrio parahaemolyticus BB22OP: VPBB_0556Help
Entry
VPBB_0556         CDS       T02409                                 

Definition
Malate synthase
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
vpb  Vibrio parahaemolyticus BB22OP
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:vpb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    VPBB_0556
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    VPBB_0556
   00630 Glyoxylate and dicarboxylate metabolism
    VPBB_0556
Enzymes [BR:vpb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     VPBB_0556
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1:605071..606699
Genome map
AA seq 542 aa AA seqDB search
MLAQTEQKTQPSQQTQGMLEVTGALAPEHQAIFPVEAQTFLSLLCEKFAGRVEELLEARE
EKQARIDAGELPDFLPDTQDIREGSWKILGIPQDLQDRRVEITGPTDRKMVINALNANVK
VFMADFEDSMSPAWDKVLDGQVNLRDAVNGNISYTNPSNGKHYQLVDEPAVLICRVRGLH
LKEKHVTWHGQIIPGALFDFALYFYNNHKALLQKGSGPYFYLPKLQSYHEAKWWSEVFHF
TEEYFGLETGTIKATVLIETLPAVFEMDEILFSLKEHIVGLNCGRWDYIFSYIKTLKKHP
DRVLPDRQVVTMDKPFLNAYSRMLVRTCHKRGAFAMGGMAAFIPAKDPQENQKVLDKIHN
DKSLEANNGHDGTWVAHPGLADTAMEVFSAALGERTNQLDVSRSEDAPITAAELLEPCDG
ERTEEGMRHNIRVALQYIEAWISGNGCVPIYGLMEDAATAEISRASIWQWIQHGKSLDNG
QQVTKALFETYLQEEVEVVKQEVGEERYQAGRFEEAAQLMAKLTTSDELTNFLTVPGYDY
LD
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgcttgctcagacagaacaaaaaacacaaccatcacagcaaacccaaggcatgcttgag
gtgactggagcacttgctccggagcatcaagctattttccctgttgaagcccaaaccttt
ttatctctgctgtgtgaaaaatttgctgggcgtgttgaagagttgttggaagcgagagaa
gaaaagcaagcacgcatcgacgctggggagttgccagacttcctgcctgacacacaagat
attcgtgaaggtagttggaagatcttaggtattcctcaggatctacaagatcgccgtgtt
gagattacaggcccaacagatcgcaaaatggtgatcaacgctttgaatgcaaatgtaaaa
gtattcatggcggatttcgaagactctatgtcgccagcttgggacaaggttctcgatggt
caagttaacttgcgagatgccgttaatggcaacattagctacaccaaccctagcaatggc
aagcattatcagctggtggacgagccagcggtgttgatctgccgtgttcgcggccttcac
ttaaaagaaaaacacgtgacgtggcacggtcagatcattccaggcgcgctttttgatttt
gcactgtatttctacaataaccacaaagcattgcttcaaaaaggcagcggtccatatttc
tatcttcctaaactgcagtcttatcatgaggcgaagtggtggagtgaagtgttccatttc
acagaagaatattttggtttagagactggcacgatcaaagcgaccgtgctgatcgaaacg
ttaccagctgtgtttgagatggatgagattttgttctcacttaaagagcatatcgtaggg
ctgaattgtggtcgttgggattacattttcagttacatcaaaacactgaagaaacaccca
gatcgtgttctgccggatcgccaagtcgtcaccatggacaaaccatttttgaacgcctat
tcgcgtatgttggttcgtacttgtcacaagcgtggtgctttcgcgatgggaggaatggcc
gcctttattcccgcgaaagacccgcaagaaaaccagaaagtgttggataaaattcacaac
gataaatcacttgaggcgaataacggtcacgacggtacgtgggttgcccacccgggtcta
gccgatactgctatggaagtattcagtgcggcacttggagagcgaacaaatcaactagat
gttagtcgctccgaagatgcgccaattaccgcagccgagttgctagaaccgtgtgacggt
gaacgtacagaagaaggcatgcgccacaacattcgcgttgcgctgcaatacatcgaagct
tggatttctggaaacggctgtgtaccaatctacggattaatggaagatgctgcgactgct
gagatttctcgcgcctcaatctggcaatggattcagcacggtaagtcactcgacaatggt
caacaggtgacaaaagcactgttcgaaacctacttgcaagaagaagtagaagtagtgaaa
caagaagtgggcgaagaacgttatcaagccgggcgttttgaagaagccgcacaattgatg
gcgaagctaacaactagtgatgagctaaccaacttcttaaccgttcctggttatgactac
ctagactaa

DBGET integrated database retrieval system