KEGG   Vibrio parahaemolyticus BB22OP: VPBB_0556Help
Entry
VPBB_0556         CDS       T02409                                 

Definition
Malate synthase
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
vpb  Vibrio parahaemolyticus BB22OP
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:vpb01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:vpb00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:vpb00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:605071..606699
Genome map
AA seq 542 aa AA seqDB search
MLAQTEQKTQPSQQTQGMLEVTGALAPEHQAIFPVEAQTFLSLLCEKFAGRVEELLEARE
EKQARIDAGELPDFLPDTQDIREGSWKILGIPQDLQDRRVEITGPTDRKMVINALNANVK
VFMADFEDSMSPAWDKVLDGQVNLRDAVNGNISYTNPSNGKHYQLVDEPAVLICRVRGLH
LKEKHVTWHGQIIPGALFDFALYFYNNHKALLQKGSGPYFYLPKLQSYHEAKWWSEVFHF
TEEYFGLETGTIKATVLIETLPAVFEMDEILFSLKEHIVGLNCGRWDYIFSYIKTLKKHP
DRVLPDRQVVTMDKPFLNAYSRMLVRTCHKRGAFAMGGMAAFIPAKDPQENQKVLDKIHN
DKSLEANNGHDGTWVAHPGLADTAMEVFSAALGERTNQLDVSRSEDAPITAAELLEPCDG
ERTEEGMRHNIRVALQYIEAWISGNGCVPIYGLMEDAATAEISRASIWQWIQHGKSLDNG
QQVTKALFETYLQEEVEVVKQEVGEERYQAGRFEEAAQLMAKLTTSDELTNFLTVPGYDY
LD
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgcttgctcagacagaacaaaaaacacaaccatcacagcaaacccaaggcatgcttgag
gtgactggagcacttgctccggagcatcaagctattttccctgttgaagcccaaaccttt
ttatctctgctgtgtgaaaaatttgctgggcgtgttgaagagttgttggaagcgagagaa
gaaaagcaagcacgcatcgacgctggggagttgccagacttcctgcctgacacacaagat
attcgtgaaggtagttggaagatcttaggtattcctcaggatctacaagatcgccgtgtt
gagattacaggcccaacagatcgcaaaatggtgatcaacgctttgaatgcaaatgtaaaa
gtattcatggcggatttcgaagactctatgtcgccagcttgggacaaggttctcgatggt
caagttaacttgcgagatgccgttaatggcaacattagctacaccaaccctagcaatggc
aagcattatcagctggtggacgagccagcggtgttgatctgccgtgttcgcggccttcac
ttaaaagaaaaacacgtgacgtggcacggtcagatcattccaggcgcgctttttgatttt
gcactgtatttctacaataaccacaaagcattgcttcaaaaaggcagcggtccatatttc
tatcttcctaaactgcagtcttatcatgaggcgaagtggtggagtgaagtgttccatttc
acagaagaatattttggtttagagactggcacgatcaaagcgaccgtgctgatcgaaacg
ttaccagctgtgtttgagatggatgagattttgttctcacttaaagagcatatcgtaggg
ctgaattgtggtcgttgggattacattttcagttacatcaaaacactgaagaaacaccca
gatcgtgttctgccggatcgccaagtcgtcaccatggacaaaccatttttgaacgcctat
tcgcgtatgttggttcgtacttgtcacaagcgtggtgctttcgcgatgggaggaatggcc
gcctttattcccgcgaaagacccgcaagaaaaccagaaagtgttggataaaattcacaac
gataaatcacttgaggcgaataacggtcacgacggtacgtgggttgcccacccgggtcta
gccgatactgctatggaagtattcagtgcggcacttggagagcgaacaaatcaactagat
gttagtcgctccgaagatgcgccaattaccgcagccgagttgctagaaccgtgtgacggt
gaacgtacagaagaaggcatgcgccacaacattcgcgttgcgctgcaatacatcgaagct
tggatttctggaaacggctgtgtaccaatctacggattaatggaagatgctgcgactgct
gagatttctcgcgcctcaatctggcaatggattcagcacggtaagtcactcgacaatggt
caacaggtgacaaaagcactgttcgaaacctacttgcaagaagaagtagaagtagtgaaa
caagaagtgggcgaagaacgttatcaagccgggcgttttgaagaagccgcacaattgatg
gcgaagctaacaactagtgatgagctaaccaacttcttaaccgttcctggttatgactac
ctagactaa

DBGET integrated database retrieval system