KEGG   Vibrio parahaemolyticus BB22OP: VPBB_0557Help
Entry
VPBB_0557         CDS       T02409                                 

Definition
Isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
vpb  Vibrio parahaemolyticus BB22OP
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:vpb01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:vpb00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:606818..608128
Genome map
AA seq 436 aa AA seqDB search
MTLTRRQQIEALEKDWATNPRWKNVKRTYTAEEVVELRGSMVPANTIAQRGADKLWSLVN
GSAKKGYVNCLGALTGGQAVQQAKAGIEAIYLSGWQVAADNNTASTMYPDQSLYPVDSVP
SVVKRINNSFRRADQIQWANGKSPEDEGGIDYFLPIVADAEAGFGGVLNAYELMKSMIEA
GAAGVHFEDQLASVKKCGHMGGKVLVPTQEAVQKLVAARLAADVSGTTTLVIARTDANAA
DLLTSDCDPYDKDFIEGERTQEGFYRVRAGIDQAISRGLAYAPYADLIWCETATPCLEEA
RKFAEAIHAEYPDQLLAYNCSPSFNWEKNLDAETIAKFQQELSDMGYKYQFITLAGIHNM
WFNMFELAHAYAQGEGMRHYVEKVQRPEFQAAEKGYTFVAHQQEVGTGYFDRMTNTIQGG
NSSVTALTGSTEEDQF
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgacattgactcgtcgccaacaaattgaagctctggaaaaagactgggcaacgaatcca
cgctggaaaaacgtaaagcgtacgtatactgcagaagaagtcgtagaactgcgtggctcg
atggtaccagcaaatacaatcgcacaacgtggtgctgataagctgtggtcactggtcaac
ggcagtgcgaaaaaaggttatgtaaactgtcttggtgcactgacaggtggtcaagccgta
caacaagcgaaagcgggtatcgaagcgatttacctatcaggctggcaggttgcggcagat
aataacactgcatcgactatgtacccggatcagtcgctatacccagtggactcagtacct
tcagtggttaagcgcatcaacaactctttccgtcgtgctgaccaaattcagtgggcgaat
ggcaagtctcctgaagatgaaggtggtattgattacttcctaccaatcgtagcggacgca
gaggcgggctttggtggcgtgctaaacgcatacgaactgatgaagtctatgatcgaagcc
ggtgccgctggtgttcactttgaagaccaactcgcttcggttaaaaaatgtggtcacatg
ggcggtaaagtactggttccgactcaagaagcggtacaaaaactggtagctgcgcgtctt
gctgcagacgtttctggtacaacaacgttagttattgcacgtactgatgcgaacgcggca
gacctgctaacttcagattgcgacccatacgataaagactttattgaaggtgagcgtact
caagaaggcttctaccgtgtacgtgcaggtatcgaccaagcgatttctcgtggtttggct
tatgcgccatatgcagacttgatttggtgtgaaactgcgacgccgtgtctagaagaggcg
cgtaagttcgcagaagcgattcacgctgagtatccagatcagctgctggcatacaactgt
tcgccatcgttcaactgggagaaaaatctcgatgcagaaaccattgcgaagttccagcaa
gagctttcagacatgggctacaagtaccagttcatcacgctagcgggtatccacaacatg
tggtttaacatgtttgaattggcacacgcttatgcgcaaggtgaaggtatgcgtcattac
gttgagaaagttcaacgtcctgaattccaagcagcagagaaaggctacaccttcgtggct
caccaacaagaagtgggtacaggttacttcgatagaatgacgaacaccatccaaggtggt
aactcatctgtcactgcgcttaccggttcgaccgaagaagaccaattctaa

DBGET integrated database retrieval system