KEGG   Vibrio parahaemolyticus BB22OP: VPBB_0646Help
Entry
VPBB_0646         CDS       T02409                                 

Definition
Glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
vpb  Vibrio parahaemolyticus BB22OP
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:vpb00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    VPBB_0646
  Amino acid metabolism
   00330 Arginine and proline metabolism
    VPBB_0646
Enzymes [BR:vpb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     VPBB_0646
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:706908..708047
Genome map
AA seq 379 aa AA seqDB search
MTTNQQNAVVSQPQTVVVKLGTSVLTGGTLALDRAHMVELARQCAELKKQGHSVVMVSSG
AIAAGREHLGYPALPNEMASKQLLAAVGQSRLIQTWESLFGIYGIKIGQMLLTRADLDDR
ERFLNARDTINALVANDIIPIVNENDAVATSEIKVGDNDNLSALVGILCGADKLLLLTDQ
KGLFTADPRKDPNAELIKEVKTIDDTLRKIAGGSGTTLGTGGMATKLQAADIARRAGIEV
IIAAGSAPNVIFDSLSTEPQGTRFLPCSEALENRKRWILAGPAASGDIIIDDGAVNAVVG
KGSSLLAKGVIKVSGDFARGEVARVTNSHGKLVARGISAYSSEDLAKITGKHSKDIISIL
GHDYGSEVIHRDDLVVIQE
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgacaacgaatcaacaaaacgcagttgtttcgcaaccacaaaccgtcgttgtgaaactg
ggtacaagtgtgctgacaggcggcacattggcactagatcgcgctcacatggttgagcta
gcgcgtcagtgtgctgagcttaagaaacaaggccattcagtggtaatggtttcgtctggt
gcaattgcagcaggccgtgagcatcttggataccccgcactgcccaacgagatggcgagc
aaacagttgcttgctgctgtggggcagagtcgtttgattcaaacatgggagtctttgttt
ggtatttacggtatcaagattggtcaaatgctactgactcgtgctgatttggatgatcgt
gagcgttttcttaatgcgcgtgacaccatcaatgcgcttgtggcgaacgatattattcca
atcgtgaacgaaaatgatgcagtagccaccagtgaaatcaaagtcggcgacaatgacaac
ctatcggctttagtcggtattttgtgtggtgcagataagttattgctactgacagatcaa
aaaggtctgtttactgctgacccacgaaaagatccgaatgcagagctgatcaaagaagtt
aaaaccattgatgacacgttgcgtaaaattgctggcggcagcggtacaacactcggtacg
ggtggtatggcgacgaaacttcaagcagccgacatcgcacgtcgcgcgggtattgaagtt
attatcgcagcaggtagcgcgccaaacgtaatttttgactcgttgagcacggagcctcaa
ggtacgcgtttcctaccttgttcagaagcattggaaaaccgtaagcgttggatcctcgca
ggtcctgcagcatcgggtgacattatcatcgatgatggagcggtgaatgcggttgttggt
aaaggcagcagcttgctagcaaaaggggtcatcaaggtgagcggtgattttgcccgtggt
gaagttgctcgcgtaacaaattctcatggcaaactggttgcgcgtggtattagcgcctac
tcaagtgaagacttggcaaaaattactggcaaacacagtaaagacatcatctctattttg
ggtcatgactacggctcagaagtgattcatcgcgatgatcttgtcgtcattcaagaatag

DBGET integrated database retrieval system