KEGG   Vibrio parahaemolyticus BB22OP: VPBB_0723Help
Entry
VPBB_0723         CDS       T02409                                 

Definition
Beta-hexosaminidase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
vpb  Vibrio parahaemolyticus BB22OP
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vpb00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    VPBB_0723
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    VPBB_0723
Enzymes [BR:vpb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     VPBB_0723
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:788739..791390
Genome map
AA seq 883 aa AA seqDB search
MLKPSLIAASVIATLAGCSALQSSEQQVVNSLADNLDIQYQVLTNHGANEGLACQDLGAE
WASCNKVNMTLVNQGEAVNSKDWAIYFHSIRLILDVDNEQFKISRVTGDLHKLEPTDKFD
GFAAGEEVVLPLIGEYWQLFETDFMPGAFVAAPNAEPKMIASLNTEDVASFVTGLEGNNL
KRTPDDNNIFASAVSRFEKNDDLVKQDVSTTLLPTPMHVEAGKGKVDITEGIALPKDVFD
AAQFAAIQDRAEVVGVDVRGDLPVSITVVPADFTGELAKSGAYEMSINGDGIAIKAFDKV
GAFYAVQSIFGLVDSQNADSLPQLSIQDAPRFDYRGVMVDVARNFHSKDAILATLDQMAA
YKMNKLHLHLTDDEGWRLEIPGLPELTEVGSNRCFDLEEKSCLLPQLGSGSTSDNFGSGY
FSKADYVEILKYAKARNIEVIPEIDMPAHARAAVISMEARYNRLIEEGKEAEANEYRLMD
PQDTSNVTTVQFYNKQSFINPCMESSTRFVDKVISEVAAMHQEAGAPLTTWHFGGDEAKN
IKLGAGFQDVNAEDKVSWKGTIDLSKQDKPFAQSPQCQTLIADGTVSDFGHLPSHFAEEV
SKIVAEKGIPNFQAWQDGLKYSEGEKAFATENTRVNFWDVLYWGGTSSVYEWSKKGYDVI
VSNPDYVYMDMPYEVDPKERGYYWATRATDTRKMFGFAPENMPQNAETSVDRDGNGFTGK
GEIAAKPFYGLSAQLWSETVRNDEQFEYMVFPRVLAAAERAWHRAEWENDYKVGVEYSQN
SNLVDKASLNQDYNRFANVLGQRELAKLEKSGIDYRLPVPGAKVEDGKLAMNVQFPGVKL
QYSLDGKNWLNYADNARPNVKGEVFIRSVSATGEKTSRVTSVK
NT seq 2652 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaacctagtttgattgctgcttctgttatcgcaacactagcaggttgttctgct
ctgcaaagctctgagcaacaagttgtaaattcactggctgataaccttgatatccagtat
caagtgctcaccaaccatggtgctaatgaaggtcttgcatgtcaggatttgggcgctgag
tgggcatcttgtaacaaggtcaacatgacgctagtaaaccaaggcgaagcagttaactca
aaagattgggcgatctactttcacagcattcgtttgatcctagatgtcgacaatgaacag
tttaaaatctctcgcgtaacgggtgatctacacaaacttgaaccaactgataagtttgat
ggttttgcagcgggtgaagaggttgtcctgcctctgatcggtgaatactggcagcttttt
gaaacagactttatgccgggtgcatttgttgcagcgccaaacgctgaacctaaaatgatc
gcttctctcaatactgaagatgtggcttcttttgtcactggtcttgagggtaataaccta
aaacgtacaccagatgacaacaacatctttgccagtgcggtatcgcgtttcgagaagaac
gacgacttagtgaaacaagacgtctccacgacgttgttaccaacgccaatgcacgttgag
gcgggcaaaggcaaagtcgatattacagaaggtattgcgctgcctaaagatgtatttgat
gcggctcagttcgcagcgattcaagatcgtgcagaagtggtaggtgtggatgttcgtggt
gatcttcctgtaagcatcactgttgttcctgcagacttcaccggtgaattagcaaaatcg
ggtgcttacgaaatgagcatcaacggcgacggtatcgcgattaaagcatttgataaagtg
ggtgctttctacgcggtacaatctatctttggcctggtagatagccaaaatgctgattct
ctaccacaactgtccatccaagacgcaccacgttttgactaccgtggcgtgatggtggat
gtggctcgtaacttccactctaaagatgccatccttgcaacgctagaccaaatggcggcg
tacaagatgaacaaactgcaccttcacctaacggatgatgagggttggcgtcttgaaatt
ccgggtctgccagagctgactgaagtaggttctaaccgctgttttgaccttgaagaaaaa
agttgcttgttgccacaactaggttctggctcaacttctgacaacttcggctctggctac
ttcagcaaagcagattacgtggaaatcctgaagtatgcgaaagcacgtaacattgaagta
attcctgaaattgatatgccagcacacgctcgagcagcagttatctcaatggaggcacgt
tacaaccgcctaatcgaagaaggtaaagaggcggaagcgaacgagtaccgtctgatggat
cctcaagatacatcgaacgtaacaacggttcagttctacaacaagcagagctttatcaac
ccatgtatggaatcttccactcgctttgttgataaagtgatttcagaagtcgcagcaatg
caccaagaagcgggcgcaccgctaacaacatggcactttggtggtgacgaagcgaagaac
attaagctaggcgctggtttccaagatgtgaacgctgaagacaaagtaagctggaagggt
acgattgacctgtctaaacaagacaagccgttcgcacaatctccacaatgtcagacgcta
attgcagacggtacagtaagcgattttggtcaccttccaagccacttcgcagaagaagtg
tcgaagattgtggctgagaaaggcattccaaacttccaagcttggcaagatggccttaag
tacagtgaaggtgagaaagcgttcgcaacagaaaacacacgtgttaacttctgggacgtt
ctttactggggtggcacatcatcagtgtacgagtggtctaagaaaggttacgacgtgatc
gtttctaacccagattacgtgtacatggacatgccatacgaagtagacccgaaagagcgt
ggttactactgggcaacacgtgcaacagatactcgtaagatgttcggttttgcaccagag
aacatgcctcagaacgcggaaacctcagttgaccgcgatggcaatggctttactggtaaa
ggtgaaatcgcagcgaaacctttctacggtctatctgcacagctttggtctgaaaccgtg
cgtaacgacgagcagttcgagtacatggtattccctcgcgtacttgctgcggcagagcgt
gcatggcaccgtgctgagtgggaaaacgactacaaagtgggtgttgaatactcgcaaaac
tctaacctagttgataaagcatcgctaaaccaagactacaaccgctttgcaaacgtgctt
ggtcaacgtgaactggctaagttagagaaatctggtatcgactaccgtctaccagtacca
ggtgcgaaagtagaagatggcaagctagcaatgaacgttcagtttcctggcgtgaagctt
caatactctctagacggcaaaaactggctgaattacgcagacaatgctcgtccaaatgtg
aaaggtgaagtgttcatccgatctgtatcggcaacaggtgagaaaacaagtcgtgtgact
agcgtaaaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system