KEGG   Vibrio parahaemolyticus BB22OP: VPBB_0784Help
Entry
VPBB_0784         CDS       T02409                                 

Definition
Asparagine synthetase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
vpb  Vibrio parahaemolyticus BB22OP
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vpb00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    VPBB_0784
Enzymes [BR:vpb01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     VPBB_0784
Peptidases [BR:vpb01002]
 Cysteine Peptidases
  Family C44
   VPBB_0784
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(852780..854444)
Genome map
AA seq 554 aa AA seqDB search
MCSVFGILDIKSDAAALRPIALEMSKKLRHRGPDWSGIYSSERAILAHERLAIVGLNSGA
QPLYSPDKKLILAVNGEIYNHKEIRARYEGKYEFQTDSDCEVILALYQDMGADLLEELNG
IFAFVLYDEEKDEYLVGRDHIGIIPLYQGYDEHGNYYVASEMKALVPVCKTVSEFPPGSH
YSSKDAEPQRYYIRDWNEYAAVQGNSTSKEELTEALEAAVKRQLMTDVPYGVLLSGGLDS
SITSAVAKRYAAMRIEDDEKSEAWWPQLHSFAVGLEGAPDLKAAREVAEKIGTVHHEMTY
TIQEGLDAIRDVIYHIETYDVTTIRASTPMFLMGRKIKAMGIKMVLSGEGADEIFGGYLY
FHKAPNAKEFHEETVRKLLALNMFDCARANKSLAAWGVEGRVPFLDKEFIDVAMRLNPAD
KMCGNGKMEKHILRECFEHYLPDSIAWRQKEQFSDGVGYSWIDTLKAVAEEKVTDQQMET
AQYRFPYNTPTTKEGYVYREIFEELFPLPSAAECVPGGPSVACSSAKAIEWDESFKNCVD
PSGRAVQTVHNDAY
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgtgttcagtatttgggattttagacattaaaagtgatgcagcggcactgcgtcctatc
gcgttagaaatgtcgaaaaagcttcgtcaccgtggccctgactggtctggtatctactct
tcagaaagagcaatcctagctcacgagcgcttggctatcgttggtctaaatagcggtgct
caaccactatacagccctgataaaaaactaatccttgccgttaacggtgagatctacaac
cacaaagagattcgcgctcgctacgaaggcaagtacgaattccaaacagactctgactgt
gaagttattcttgcgctataccaagatatgggtgctgaccttcttgaagagctaaacggc
atttttgctttcgtactgtacgatgaagaaaaagatgagtacctagtaggtcgtgaccat
atcggtatcattccactttaccaaggttacgatgaacacggtaactactacgtcgcttcc
gaaatgaaagcactcgtacccgtttgtaaaacagtcagtgaattccctccaggttcgcac
tacagctcaaaagatgcagaacctcagcgttactacatccgtgactggaacgaatatgct
gctgttcaaggtaacagcacgagtaaagaagaactaacagaagcactggaagccgctgtg
aaacgtcaactaatgactgacgtaccatacggcgtactactatctggtggtctggattca
tccatcacatctgcggtagcaaaacgctatgctgcgatgcgtatcgaagacgatgaaaaa
tcagaagcatggtggcctcaacttcactcttttgccgttggtcttgaaggcgctccagac
ttaaaagcagcacgtgaagtggcagaaaaaattggcaccgttcaccacgaaatgacatac
accattcaagaaggtttggatgctattcgtgacgtgatttaccacatcgagacttatgac
gtaacaacgattcgtgcctcaacaccgatgttcctcatgggccgtaaaatcaaggcaatg
ggcatcaaaatggtgctttctggtgaaggcgctgatgaaatcttcggtggctacttgtac
ttccacaaagcgccaaacgcaaaagagttccacgaagaaacggttcgtaaactgctggct
ctaaacatgtttgactgtgcccgtgctaacaaatcgttggcggcatggggcgttgaaggc
cgtgtaccattcttggataaagagttcattgacgtcgcaatgcgcttaaaccctgcagac
aaaatgtgtggcaacggtaagatggaaaaacacattcttcgcgaatgttttgagcattac
ttaccagactcaatcgcttggcgtcaaaaagagcagttttctgatggcgtaggttacagc
tggattgacactttgaaggccgtagcagaagagaaagtgaccgatcaacagatggaaacg
gctcagtaccgcttcccatacaacacaccaacaactaaagaaggttacgtataccgcgaa
atttttgaggagttgttcccattaccatcagctgcagaatgtgtaccaggtggtccttct
gtagcgtgttcatcagcgaaagcgattgagtgggatgagtcattcaagaactgtgttgac
ccttcaggccgtgcagtgcaaaccgttcacaacgacgcttactaa

DBGET integrated database retrieval system