KEGG   Vibrio parahaemolyticus BB22OP: VPBB_0801Help
Entry
VPBB_0801         CDS       T02409                                 

Definition
Succinate dehydrogenase hydrophobic membrane anchor protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
vpb  Vibrio parahaemolyticus BB22OP
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:vpb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    VPBB_0801
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    VPBB_0801
   00650 Butanoate metabolism
    VPBB_0801
  Energy metabolism
   00190 Oxidative phosphorylation
    VPBB_0801
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:871954..872298
Genome map
AA seq 114 aa AA seqDB search
MVKHVSSFGRNGVHDFLLIRATAIIMTLYTIYLVSFCAFSDISYASWTQFFGGTFTKVFT
MLALASVLIHAWIGMWQVFTDYIKCAKLRGALQLGVIAVLFGYVFSGLFILWGA
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaacacgtatcttcatttggtcgtaatggtgtacacgatttcctactgattcgt
gcaacagccatcattatgacgctatacacgatttatctggttagcttctgtgcattttca
gatatctcttacgcatcatggacccaattctttggtggtactttcaccaaagtcttcacc
atgttggcgcttgcatctgttctgattcatgcatggatcggtatgtggcaagtgttcacc
gactacattaagtgcgcgaaacttcgtggtgcacttcaacttggtgtgattgccgtttta
ttcggttatgtcttctctggtctatttattctgtggggtgcgtaa

DBGET integrated database retrieval system