KEGG   Vibrio parahaemolyticus BB22OP: VPBB_0805Help
Entry
VPBB_0805         CDS       T02409                                 

Definition
Dihydrolipoamide succinyltransferase component (E2) of 2-oxoglutarate dehydrogenase complex
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
vpb  Vibrio parahaemolyticus BB22OP
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Class
Metabolism; Overview; Carbon metabolism [PATH:vpb01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:vpb00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:vpb00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:877814..879019
Genome map
AA seq 401 aa AA seqDB search
MTIEILVPDLPESVADATVATWHKQPGDTVERDEVLVDIETDKVVLEVPAPEAGVLEAIL
EVEGATVLSKQLLAKLKAGAVAGEPTADKTEATEASPDKRHKATLTEESNDALSPAVRRL
LAEHGLEAHQVKGTGVGGRITREDIEAHLANAKAAPKADAPAVEAPATARSEKRVPMTRL
RKTVANRLLEAKNSTAMLTTFNEVNMKPIMDLRKQYKDQFEERHGIRLGFMSFYVKAVTE
ALKRYPEVNASIDGDDIVYHNYFDISMAVSTPRGLVTPVLKDCDKLGFADVEKGIKELAI
KGRDGKLTVDELMGGNFTITNGGVFGSLMSTPIINPPQSAILGMHKIQERPMAVNGKVEI
LPMMYLALSYDHRLIDGRESVGFLVTIKELLEDPARLLLDV
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgacaattgaaattctggttccagatttacctgaatcagttgctgatgcaaccgtggcg
acatggcacaaacaaccaggcgacaccgtagagcgtgatgaagttctggttgatattgaa
actgacaaagttgtactagaagtgccagctccagaagccggcgttttagaagccattctt
gaagtagaaggtgcaacggtactttcaaagcaacttcttgctaaattgaaagccggcgct
gttgcgggcgagccaaccgcagacaaaacagaagcaacagaagcttctccagataagcgt
cacaaagcgacactgactgaagaaagtaatgatgcacttagccctgccgttcgtcgttta
cttgcggaacatggtctagaagcacaccaagttaaaggtactggtgttggcggtcgtatt
actcgtgaagatatcgaagcgcatctagcaaacgctaaagcggctccaaaagctgatgct
ccagcagttgaagcaccagcaaccgctcgtagtgagaagcgtgtgccaatgactcgtcta
cgtaagacggttgcaaaccgcctattggaagcgaaaaacagcaccgcaatgctaacgacg
tttaacgaagtgaacatgaagccaatcatggatcttcgtaagcaatacaaagaccagttc
gaagagcgtcacggtattcgtcttggcttcatgtctttctatgtgaaagcagtgacagaa
gcactaaaacgttacccagaagtaaatgcatcaatcgatggtgatgatatcgtttaccac
aactactttgacattagcatggcggtatcaacgccacgcggtctagtaactccagtgcta
aaagactgtgacaaacttggctttgcagatgttgaaaaaggcatcaaagagctagcgatc
aaaggtcgtgatggcaagctaacagttgatgagttaatgggtggtaacttcactatcact
aacggtggtgtgttcggttctctaatgtctacgcctatcatcaaccctccgcaatctgca
atccttggtatgcataaaatccaagaacgcccgatggctgtaaacggtaaagttgaaatc
ctaccgatgatgtacctagcgctatcttacgaccaccgtttgatcgatggtcgtgagtca
gttggcttcctagtaacgattaaagagctactagaagatccagcgcgtctcctattagac
gtttaa

DBGET integrated database retrieval system