KEGG   Vibrio parahaemolyticus BB22OP: VPBB_0806Help
Entry
VPBB_0806         CDS       T02409                                 

Definition
Succinyl-CoA ligase [ADP-forming] beta chain
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
vpb  Vibrio parahaemolyticus BB22OP
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:vpb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    VPBB_0806
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    VPBB_0806
   00640 Propanoate metabolism
    VPBB_0806
   00660 C5-Branched dibasic acid metabolism
    VPBB_0806
Enzymes [BR:vpb01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     VPBB_0806
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:879214..880380
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQAKQLFAEFGLPVPEGYACDTPQEAFEAAGRISTAKKVVKCQVHAGGRGKAGGV
ELHDTKEGVKEFAQKWLGKNLVTYQTDANGQPVTKILVEEASNIANELYLGAVVDRASRK
IVFMASTEGGVEIEKVAEETPELIHKAAIDPLVGPQAYQGRELAFKLGLEGDQIKQFVKI
FMGLGTMFSQYDLALLEINPLVITAEGNLLCLDGKINIDSNALYRQPKLREMHDPSQEDE
REAHAAQWELNYVALDGNVGCMVNGAGLAMGTMDIVNLHGGKPANFLDVGGGATKERVAE
AFKIILSDDNVKAVLVNIFGGIVRCDMIAEGIIGAVKEVGVNVPVVVRLEGTNADLGREV
LANSDVDIIAAESLTDAAQKVVAAAEAK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatttgcatgaataccaagccaaacagctgtttgcagaattcggtttgcctgtgcca
gaaggctacgcatgtgatacaccacaagaagcgtttgaagcagcaggccgtatcagcaca
gcaaagaaagtagtcaagtgtcaggttcacgctggtggccgcggtaaagcgggtggcgta
gagcttcacgacactaaagaaggtgtaaaagagtttgcgcaaaagtggctaggtaaaaat
ctagtaacttaccaaacagatgcaaatggtcagccagttacaaaaatccttgttgaagaa
gcgtcaaacattgccaacgaactttacttaggtgcggtagttgaccgtgctagccgtaag
atcgttttcatggcttctacagaaggcggtgtggaaatcgaaaaagttgcggaagaaacg
ccggagctaatccacaaagcagccatcgatccactagtaggccctcaagcttaccaaggt
cgtgagcttgcgttcaaacttggtcttgaaggtgaccaaatcaaacaattcgttaagatc
tttatgggtcttggcactatgttctctcagtatgaccttgctctactagagatcaacccg
cttgtgattactgctgaaggcaacctgctatgtcttgacggtaagatcaacatcgactca
aacgcactttaccgtcagcctaagctacgtgaaatgcacgatccatcacaagaagatgag
cgtgaagcgcacgcagctcagtgggaactgaactacgtagcactagacggtaacgttggc
tgtatggttaacggtgcaggtctagcaatgggtacgatggatatcgtaaacctacacggc
ggcaaaccagcgaacttcctagatgtaggtggcggcgcaactaaagagcgtgttgctgaa
gcattcaagatcatcctatctgatgacaacgtgaaagcggtactcgtaaacatcttcggt
ggtatcgttcgttgtgacatgatcgcagaaggtattatcggcgcggttaaagaggtaggt
gtaaacgtacctgttgttgttcgtttggaaggtactaacgcggaccttggtcgcgaagtt
cttgctaattctgatgttgatatcattgctgctgagtcgctaacggatgctgctcagaaa
gttgttgctgctgcggaggctaaataa

DBGET integrated database retrieval system