KEGG   Vibrio parahaemolyticus BB22OP: VPBB_0998Help
Entry
VPBB_0998         CDS       T02409                                 

Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
vpb  Vibrio parahaemolyticus BB22OP
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:vpb00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    VPBB_0998
Enzymes [BR:vpb01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     VPBB_0998
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1105100..1105771
Genome map
AA seq 223 aa AA seqDB search
MSIQFFIILSQIHFQRVFIVIGRLRGILLEKQPPEVLIEVNGIGYEVQMPMSCFYELPNI
GEEAIIYTHFVVREDAQLLYGFNTVKERALFREVIKANGVGPKLGLGILSGMTASQFVSC
VEREDVSTLVKLPGVGKKTAERLVVEMKDRLKGWGAGDLFTPFTDAAPTDSAAASSNSAE
EEAVSALLALGYKPTQASKVVSQIAKPDMSSEQLIREALKSMV
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgtctatccagttctttattatcctgtcgcaaattcatttccaaagagtatttatagtg
attggacgtcttcgcggcattttgcttgaaaagcaaccacctgaagttttaattgaagtt
aacggcattggctatgaagttcagatgccaatgagctgtttctacgaactgccaaatatc
ggcgaagaagcgattatttatactcattttgttgtgcgtgaagacgcgcaattgctttac
ggttttaatacagtaaaagagcgtgcgctattccgtgaagtgatcaaagcaaacggcgtt
ggccctaaacttggcttgggtattctttcaggcatgacagcgagccagttcgtgtcttgt
gtagagcgtgaagatgtttctacgcttgtgaagttacctggtgttggtaagaaaaccgcc
gagcgtttggtcgttgaaatgaaagaccgcttaaaaggttggggagctggcgacttattc
acgccgtttactgatgccgctcctactgactcggctgccgcttcgtcaaatagtgcagaa
gaagaggcggtcagcgcacttcttgctctaggctacaagccaactcaagcgtcgaaagta
gtttctcaaattgctaaaccggacatgagcagcgagcagctgatccgtgaagcactaaaa
tcaatggtgtaa

DBGET integrated database retrieval system