KEGG   Vibrio parahaemolyticus BB22OP: VPBB_1077Help
Entry
VPBB_1077         CDS       T02409                                 

Definition
Thymidine kinase
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
vpb  Vibrio parahaemolyticus BB22OP
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vpb00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    VPBB_1077
Enzymes [BR:vpb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     VPBB_1077
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1189629..1190207
Genome map
AA seq 192 aa AA seqDB search
MAQMYFYYSAMNAGKSTTLLQSSFNYQERGMTPVIFTAALDDRYGVGKVSSRIGLQSDAH
LFRPDTNLYQEIAALHEVEKRHCILIDECQFLSKEQVYQLTEVVDKLHIPVLCYGLRTDF
LGELFEGSKYLLSWADKLVELKTICHCGRKANMVIRTDEHGVAIKEGDQVAIGGNDRYVS
VCRQHYKEALGK
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
gtggctcagatgtatttctattactcagcaatgaatgcgggtaaatcgacaactcttctt
caatcttcatttaactaccaagaacgcggtatgacgccagtgattttcactgcggcgttg
gacgaccgctatggtgtaggcaaagtaagttctcgtattggtttacagtcggacgcgcat
ttgttccgtccagatacgaacttataccaagagattgcagccttgcacgaagtcgaaaaa
cgtcactgtattcttattgacgagtgtcagttcctatcgaaagagcaggtttaccaactt
acagaggtagtggataagctgcatattccagtactttgctatggtcttcgtaccgatttt
cttggcgaactttttgaaggcagtaagtacctactctcttgggctgataagctggttgag
ttgaagacgatttgccactgtggccgaaaagcaaacatggttatccgcaccgacgaacac
ggagtcgcaatcaaagaaggtgaccaagtggcgattggtggcaacgaccgttatgtctca
gtttgccgtcagcactacaaagaagccctaggtaaataa

DBGET integrated database retrieval system