KEGG   Vibrio parahaemolyticus BB22OP: VPBB_1089Help
Entry
VPBB_1089         CDS       T02409                                 

Definition
Alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
vpb  Vibrio parahaemolyticus BB22OP
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:vpb00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    VPBB_1089
  Lipid metabolism
   00561 Glycerolipid metabolism
    VPBB_1089
   00600 Sphingolipid metabolism
    VPBB_1089
Enzymes [BR:vpb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     VPBB_1089
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1200495..1202234
Genome map
AA seq 579 aa AA seqDB search
MAQTIQLANHSEMTIIDNDLHVDVIGNQAHFSFSGLHNKTFTDREVLFEMPFLYEHEANV
IGDGFQMLAQTSGTITHPIEIGRCPDNIPPYRVYLQHAPKRYYNYLVIEDSAGYTLFGFT
TCRRFAGYFDIQQRNGQWILTAAIDGEHTQVADWEHNQLESITILTGNSLSDLYQEFSEM
IAAHHPIRNGVTQDAPIGWCSWYAYYADVTEQNVLENVDCMQDKLEDLEWVLLDDGYQAF
MGDWLTPSDKFSGGVKELIQNIRAKGKKPAIWMAPFIAQPESEVFKQHPEWFVRHPDGQL
LKAEDVTYGGWRCTPWYILDTSNPEVQDHLTHVVSVMRLEWGVELFKLDANYWGTLKGKR
SQSGITGVEAYRLGMEAIARGAGDAWLLGCNAPMWPSLGLVDAMRVSDDVERHSHRFEQI
AKETFFRSWQHRKLWQIDPDCATFTSLANQAASREDYEFHRTVLLASGGLLLSGDPLPEI
TPFASKTLAKLMLRQRRSQESAKFTALSLSHAFLKLTDKNDLHCLFNYANHNATEFTLTA
DQPVDWYDYWTGEKLNQDPCQLLLVSVDRGLNAKAIVTA
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
atggctcagaccattcagttagccaaccattccgaaatgacgatcatcgataacgatctg
cacgtggatgtgattggtaatcaagcccatttctctttctctgggcttcacaataagacc
tttactgaccgtgaagtgttgttcgaaatgccgtttctatacgagcacgaagccaacgtg
attggtgatggttttcaaatgttggcgcaaacgtcaggaacgatcacgcatcctattgaa
ataggtcgctgccccgacaacattcccccataccgtgtgtacttgcaacatgcacctaag
cgttactacaactatctagtgattgaggattctgctggttacaccttgtttggcttcacg
acgtgccgtcgatttgctggttactttgatatacaacagcgaaatgggcagtggatactg
accgcagcaattgatggtgaacacacgcaagtggcggattgggaacacaatcaacttgag
tccattacgattttaactggcaactcgctatccgatctgtatcaagagttcagcgagatg
attgccgcgcatcatcctattcgcaacggtgtcacgcaggatgcaccgataggctggtgt
tcttggtatgcgtactatgccgatgtgaccgagcaaaatgttttagaaaatgttgattgc
atgcaagacaagctcgaagacttagaatgggtacttctggatgatggctatcaagcgttc
atgggggattggcttacgccgtcggataaattctctggcggtgtgaaggagctgattcaa
aacattcgcgcaaaaggcaaaaagccggcgatttggatggctcctttcatcgcgcagcca
gaatctgaggtctttaagcaacatcctgaatggtttgttcgtcatcctgacggtcagctc
cttaaagccgaagatgttacctacggcggctggcgttgcacgccttggtatattctcgat
acgtctaaccccgaagtgcaagatcatctaacgcacgtggtgtcagtgatgaggctagag
tggggcgtagagctgtttaagctcgatgcaaactactggggaacgttaaaaggaaaacgt
agtcagtctggtattacgggtgtcgaagcgtatcgattagggatggaggcgatcgccaga
ggcgcaggagacgcgtggttgcttggctgcaacgcgccaatgtggccatctttggggctg
gtggatgcgatgcgcgtgtctgatgacgtcgagcgccatagccaccgttttgaacagatc
gctaaagagacgtttttccgtagctggcagcaccgtaaattgtggcaaattgacccagac
tgcgcgacgtttacttctcttgctaatcaagctgcatcacgtgaagactacgagtttcac
cgtaccgtattattggcgtctggcggcttgcttttgtctggcgaccctctcccggaaatc
acgccatttgcgagtaaaacgttggcgaagctgatgttgcgacaacgacgcagccaagaa
tctgctaagttcacggcgttaagtttgagccatgcttttttgaaactgacggacaagaat
gatctacattgtttgttcaattacgcgaatcacaatgcgactgaatttactctcacagcg
gatcagcccgttgattggtatgactactggaccggagaaaagctcaaccaagatccttgt
cagttgcttctagtgagtgtcgatagaggtctgaatgccaaagcaatagtgaccgcgtaa

DBGET integrated database retrieval system