KEGG   Vibrio parahaemolyticus BB22OP: VPBB_1186Help
Entry
VPBB_1186         CDS       T02409                                 

Definition
Phosphodiesterase
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
vpb  Vibrio parahaemolyticus BB22OP
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:vpb00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:vpb00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:vpb02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1316662..1318335
Genome map
AA seq 557 aa AA seqDB search
MSLSRRDFMKVVSSTAVATGLIGCGSDDNESVAVSFEHGVASGDPTQAQVIIWTRVTTAA
SYVDVTWQVASDVEFSNVVQSGVFTTDTGRDFTVKVDVQNLNANSQYYYRFMVGEMMSEV
GQTQTLPEDGVEKASMAVVSCANYPAGYFHVYREILNQHEQSPFDVVLHLGDYIYEYGAG
GYASEDAAALGREPSKGTECITLDDYRKRYAQYRQDADLQALHAKLPMIAVWDDHELAND
TWKNGAENHQDDEGSFIDRRAAAAAAWTEWLPVRENTFSNMLIYRQFSFGNLVNLMMLDT
RLVGRDKPLDYFSLNAPTMEAIGGLVAQSRSADRELLGTEQLAWLMNEFNTHDAKWNVLG
QQVLMSRMELPSSVMTAMFQLFTSTEEKKTEALLAVNTAITGYLADPSADPISLPYNLDA
WDGYYVEREKVYQLAKASSGNFVCLAGDTHNAWASELKDVSNNPIGVEFATSSVSSPGLE
EYLALDPVAIAQMEYTLPHLVSELQWADIKQRGFMRVTFTADAAQSTWYLVSSIKDKKYQ
VTTKSASTTNGTTLDII
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atgtctttgtctcgtcgagactttatgaaagttgtctcttcaaccgccgttgctaccggt
ctaatcggttgtggcagcgacgataatgaatccgttgccgttagttttgaacatggtgtc
gccagtggcgatccgactcaagcacaagtgattatttggactcgggtgactacagccgcg
agttacgtggatgtgacctggcaagtcgcatccgacgtggagttttccaatgtcgtgcaa
agtggcgtattcactaccgatacaggacgtgatttcacggtaaaagtggacgtacaaaac
ctcaacgccaattctcagtactactaccgatttatggtcggcgagatgatgagtgaggta
gggcaaactcaaactctgcctgaagatggtgtcgaaaaagcatcgatggcggtggtgtct
tgcgccaactatccagcgggttatttccacgtttatcgcgagatcttaaatcaacatgaa
caatcgccattcgacgttgtgttacatcttggtgactacatttatgaatatggggctgga
ggctatgccagtgaagatgccgctgcattagggcgcgaaccgagcaaaggcacagaatgt
atcactctggacgattaccgaaaaagatacgcccaatatcgtcaagatgccgatctgcaa
gcattacatgccaaactgcccatgattgcagtttgggatgatcacgagttagctaatgac
acatggaaaaatggcgcagagaaccatcaggacgacgaaggtagctttatcgaccgtcga
gctgccgctgcggctgcatggactgagtggttgccagttcgtgagaatacattctcaaac
atgttgatttatcgtcagttctcatttggcaacttagtgaatctcatgatgctcgatacg
cgccttgtcggtcgtgataagccgttggattacttctcactcaatgcaccaacaatggaa
gctatcggtgggttagttgctcaatcacgcagtgcagacagagaactgctaggcacggaa
caacttgcttggttgatgaatgaattcaacacgcacgatgcaaaatggaacgttttaggc
caacaagttttgatgtcgcgaatggagctaccaagttcagtgatgacggcgatgttccaa
ctgtttacgtcaacagaagagaagaaaacagaagctttgttggcggtgaatacagcgatc
acaggttatcttgccgatccaagtgcagatcccatttctctgccttacaacctcgatgct
tgggatggttactatgtcgagcgtgaaaaagtctaccaactggccaaagcaagtagtggc
aattttgtgtgtttagcgggcgatactcacaacgcgtgggcaagtgagctaaaagatgtg
tcaaacaatccgataggggtcgagtttgcgacgagctcggtgagctctccggggttagaa
gagtatttggcgttggatccggtggcgattgctcaaatggaatacaccttgccgcattta
gtctccgagctgcaatgggctgacatcaaacaacgtggatttatgcgagtgacctttact
gctgatgccgctcaatcgacgtggtacttggtgtcgagcatcaaagacaaaaagtatcag
gtgacgacgaagtcggcgtctacgacaaatggcacaacgttagacattatctaa

DBGET integrated database retrieval system