KEGG   Vibrio parahaemolyticus BB22OP: VPBB_1800Help
Entry
VPBB_1800         CDS       T02409                                 

Definition
(GenBank) Indole-3-glycerol phosphate synthase
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
vpb  Vibrio parahaemolyticus BB22OP
Pathway
vpb00400  Phenylalanine, tyrosine and tryptophan biosynthesis
vpb01100  Metabolic pathways
vpb01110  Biosynthesis of secondary metabolites
vpb01130  Biosynthesis of antibiotics
vpb01230  Biosynthesis of amino acids
Module
vpb_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:vpb00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    VPBB_1800
Enzymes [BR:vpb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     VPBB_1800
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     VPBB_1800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PRAI FMN_dh QRPTase_C
Motif
Other DBs
NCBI-ProteinID: AGB10272
Position
1:2004144..2005583
Genome map
AA seq 479 aa AA seqDB search
MTDFNTQQANNLSEHVSKKEAEMAEVLAKIVRDKYQWVAERKASQHLSTFQSDLLPSDRS
FYDALSGDKTVFITECKKASPSKGLIRNDFDLDYIASVYNNYADAISVLTDEKYFQGSFD
FLPQVRRQVKQPVLCKDFMVDTYQVYLARHYGADAVLLMLSVLNDEEYKALEEAAHSLNM
GILTEVSNEEELHRAVQLGAKVIGINNRNLRDLTTDLNRTKALAPTIRKLAPNATVISES
GIYTHQQVRDLAEYADGFLIGSSLMAEDNLELAVRKVTLGENKVCGLTHPDDAAKAYQAG
AVFGGLIFVEKSKRAVDFESARLTMSGAPLNYVGVFQNHDVDYVASIVTSLGLKAVQLHG
LEDQEYVNQLKTELPVGVEIWKAYGVADTKPSLLADNIDRHLLDAQVGTQTGGTGHVFDW
SLIGDPSQIMLAGGLSPENAQQAAKLACLGLDLNSGVESAPGKKDSQKLQAAFRAIRNY
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgactgacttcaacacccagcaagcaaacaacttatcagagcacgtctcaaaaaaagaa
gcagaaatggcggaagtgcttgccaaaattgttcgcgataaataccaatgggtagcagag
cgaaaagcatcacagcatctgagcacttttcaatcggatctattgccgtcggatcgcagt
ttttatgatgcattgagtggcgataaaaccgtattcattacagaatgcaaaaaggcatcg
ccatcaaaaggccttattcgcaacgacttcgatttggactacatcgcgtcggtttacaac
aactacgcagacgcgatctcggttctgaccgatgaaaaatacttccagggtagcttcgat
tttctacctcaagttcgccgacaagtgaaacaaccagtgttgtgtaaggacttcatggtc
gatacctaccaagtttaccttgctcgtcattatggcgcggatgcggtattgctcatgctt
tcggtactgaatgacgaagagtacaaagcgttagaagaagctgcgcacagcctaaatatg
ggcattttaacggaagtcagcaacgaagaagagcttcaccgcgcagttcagcttggcgct
aaagttatcggtataaacaaccgcaacttgcgcgacttaacaacggatttaaaccgaact
aaagcgcttgcgccaaccattcgtaagcttgcaccaaacgcaacggttatttcagagtct
ggcatttacactcatcaacaagttcgtgacttagcagaatatgcagacggctttttgatt
ggcagctcgctgatggcggaagacaacttagaacttgcggttcgtaaagtaacgctaggt
gaaaataaggtttgcggtctgactcacccagatgatgcggcaaaagcgtatcaagcaggc
gcagtatttggtggtctgattttcgttgagaaatcgaaacgagcggtcgattttgaaagt
gctcgcctaaccatgagcggcgcgccacttaattatgttggcgtgttccaaaatcacgac
gttgattatgtcgcctctatcgtaacgtctttgggcttaaaagccgtacagttacatggg
ctagaagatcaagagtacgtcaaccagctcaaaacagaactacccgttggcgtcgagatt
tggaaagcctacggcgtggcggatacaaagccatccttgctcgcagacaacattgaccgt
cacctactggatgctcaagttggtactcaaactggcggcacaggccacgtgttcgactgg
tctttgatcggcgatccaagtcaaatcatgctggcaggtggactgtcgcctgaaaatgca
cagcaagcagcaaaattagcctgcttgggattagatttaaactctggagtagaaagcgca
ccggggaaaaaagattcacagaagttgcaagccgcatttcgcgctattcgtaactactaa

DBGET integrated database retrieval system