KEGG   Vibrio parahaemolyticus BB22OP: VPBB_1983Help
Entry
VPBB_1983         CDS       T02409                                 

Definition
Alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
vpb  Vibrio parahaemolyticus BB22OP
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:vpb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    VPBB_1983
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    VPBB_1983
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    VPBB_1983
Enzymes [BR:vpb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     VPBB_1983
Exosome [BR:vpb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   VPBB_1983
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:2213586..2215163
Genome map
AA seq 525 aa AA seqDB search
MKRLVSPIITAVAASTLSFNALSAEIKNVILMIGDGMGPQQVGLLETYANHAPNSIYKGQ
TTALYKLAQEGVIGSSLTNPEDAIVVDSACSATMLATGIPTASEVIGIDSQGNHVETILE
KAKSKGKATGLVSDTRMTHATPAAFAAHQPHRSLENNIASDMLESGVDVLLSGGLRHWIP
KSTNDKGETYQALEKLTQGSVYLKSKRKDERNLLTEAQDQGYSLAFSRDMLAQAKGDKLL
GLFAYSGMNDGIAYSNSKNDPKRTQPSLKEMTVKALDVLSKNKDGFFLMVEGGQIDWAGH
SNDAGTMLHELIKFDEAVNSVYEWAKGRDDTLIIVTADHETGSFGFSYSSANLPKPEKRK
GEAFEKRDYAPNFNFGKFEILDGLYNQKKSYYGMISEFEALDKAQQTPEKLAEVVNANSD
FSITPEQAAHVLASKPNPYRVAGHSYLEVETVPTINDFDAFFPYNDRGNLLAREQATKQN
TVWGTGTHTHTPVNVFAWGPAETILPVSKIMHHSELGEFLKQQIK
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgtttagtttctccgattattactgcagtggctgcatctacactttcattcaat
gcgctatccgctgaaatcaaaaacgttattctgatgattggtgatggtatgggtcctcag
caagtcggcttgctagaaacctacgcgaaccacgcaccaaactcgatttacaaaggccaa
accaccgcgctctacaagttagcgcaagaaggtgtgattggctcatctttaacgaaccca
gaagatgcgatcgttgtcgactctgcatgttcggcaacaatgctcgcaacaggtatccca
accgcatcagaagtgattggtattgacagccaaggcaatcacgttgagaccattttggaa
aaagccaaaagcaaaggcaaagcaacgggtcttgtttcagatacgcgcatgacgcacgca
acaccagccgcgtttgctgcgcatcagcctcatcgctcgctagaaaacaacatcgcttcc
gatatgctagaaagcggtgtcgacgtgttgttatctggtggtcttcgtcactggattcca
aaatcgactaacgacaaaggtgaaacttaccaagcgctagaaaaacttacgcaaggcagt
gtttacctaaaatctaagcgtaaagacgaacgcaatctgcttaccgaagcgcaagaccaa
ggctacagcctagctttcagccgagacatgttggcacaagcaaaaggcgacaaactactt
ggcctattcgcttactcaggtatgaatgatggtattgcttacagtaacagcaaaaacgat
ccaaaacgcacacaaccatcgttgaaagaaatgacggtcaaagcgcttgatgttctttct
aaaaacaaagacggcttcttcttgatggttgaaggtggtcaaatcgactgggctggccac
agtaacgatgctggtaccatgctacatgagttgattaagttcgacgaagcggtgaactct
gtttacgagtgggcgaaaggtcgtgacgacacacttatcattgttaccgcagaccacgaa
acaggttcttttggctttagctactcatcagcaaatctacctaaaccagaaaaacgcaaa
ggtgaagcctttgaaaaacgtgattacgcgccaaacttcaacttcggtaagtttgaaatc
ctagatggtttatacaaccagaagaaaagctactacggcatgatcagcgagtttgaagcg
ctagataaagcacagcaaacaccagaaaagctagctgaagtggtgaatgccaacagcgat
ttttctatcacacctgagcaagccgctcatgtactagcaagcaaaccaaacccataccga
gttgctggccactcgtacctagaagtagaaacggtaccaacaattaacgactttgatgcg
ttcttcccatacaacgaccgcggtaacttgctcgctcgcgaacaagcgaccaaacaaaac
acggtatggggaacaggcacgcacactcatacaccagtgaacgtgttcgcttgggggcct
gcagaaaccattcttccagtttcaaaaatcatgcaccactccgagcttggtgagttccta
aagcaacaaatcaaataa

DBGET integrated database retrieval system