KEGG   Vibrio parahaemolyticus BB22OP: VPBB_2026Help
Entry
VPBB_2026         CDS       T02409                                 

Definition
3-hydroxyacyl-CoA dehydrogenase
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
vpb  Vibrio parahaemolyticus BB22OP
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:vpb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    VPBB_2026
   01212 Fatty acid metabolism
    VPBB_2026
  Carbohydrate metabolism
   00640 Propanoate metabolism
    VPBB_2026
   00650 Butanoate metabolism
    VPBB_2026
  Lipid metabolism
   00071 Fatty acid degradation
    VPBB_2026
   01040 Biosynthesis of unsaturated fatty acids
    VPBB_2026
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    VPBB_2026
   00310 Lysine degradation
    VPBB_2026
   00380 Tryptophan metabolism
    VPBB_2026
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    VPBB_2026
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    VPBB_2026
   00281 Geraniol degradation
    VPBB_2026
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    VPBB_2026
Enzymes [BR:vpb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     VPBB_2026
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     VPBB_2026
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     VPBB_2026
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2257810..2259921)
Genome map
AA seq 703 aa AA seqDB search
MSEQKAFSLNVDEQNIAWLAIDVPNEKMNTLQAAFADEMKEIFAQLKDSSGIKGMIIHSL
KPDNFVAGADVRMLEACTTANEAQALAKQGQELFQQLSDLPYPVVAAIHGPCLGGGLELA
LACDYRVCTDSDKTRLGLPEVQLGLLPGSGGTQRLPRLIGLLPSLDLILTGKQLRAKKAK
KLGVVDACVPDTILLDVAKQFIDKGKNKGKKKQSTKEKLMSGSGLGRKLVFEQAAKKTNQ
KTRGNYPATVAILEVIQHGLEKGFAQGQELEAKRFGELVMSSESKALRSIFFATTEMKKE
HGTDAQPAAVKKVGVLGGGLMGAGISHVTVAKAKVPVRIKDVSNDGVLNALNYNYKLFEK
QRKRRILSKADLQAKMLQLSGGVDFTSYNHIDVVIEAVFEDLDLKQQMVADIEANAKSET
IFATNTSSLPIHKIAEKAERPENIVGLHYFSPVEKMPLVEVIPHETTSDETISTVVALAK
KQGKTPIVVKDKAGFYVNRILAPYMNEAAHILLANEPIEKLDGALLDFGFPVGPITLLDE
VGVDIGAKIMPILVNELGERFKGPDVFDILLNDGRKGRKSGKGFYTYKGKKKEVDKSIYK
LLKLTPESKLSDNDIALRCVLPMLNEAVRCLDDGIIRSPRDGDIGAIFGIGFPPFLGGPF
RYMDQFGLKELVEKMNEFASKYGDRYAPCDGLLTRAGEGRTFY
NT seq 2112 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagcaaaaagcatttagtcttaacgttgatgagcagaacattgcatggttagcg
atcgacgtaccgaatgaaaagatgaacacgctacaggcagcttttgctgatgaaatgaaa
gaaatttttgctcagctaaaagactccagtggcatcaaagggatgatcattcactcctta
aaaccggataattttgtggcaggtgccgatgttcgtatgttggaggcatgtaccacagcg
aatgaagcacaagcattggcaaaacaaggtcaagagttgttccaacaactgtctgactta
ccttaccctgtagttgcggctattcatggcccatgtttgggcggcggtttagagcttgcg
cttgcatgtgattaccgtgtttgtacggattccgataagacacgcttaggcttaccagaa
gttcaactcggtctattaccgggttctggcggtactcagcgtttgccacgtttgattggt
ctgttaccgtcattggacttgatcctgacgggtaaacagcttcgcgcgaagaaagccaaa
aaactgggcgttgtggacgcgtgtgtccctgacaccattttgctcgacgtagcaaaacag
tttatcgacaaaggcaagaacaagggcaagaaaaagcaatcgacgaaagagaagttgatg
tcgggcagtgggttaggtcgtaagcttgttttcgaacaagctgcgaagaaaaccaaccag
aagacccgtggcaactatccagcaacggtcgcgattcttgaagtgattcaacacggtctg
gaaaaaggctttgcacaagggcaagagcttgaagcgaaacgatttggtgagcttgtgatg
agctccgaatcgaaagcattgcgctctatcttcttcgcgactactgaaatgaagaaggaa
cacggcacggatgcacagccagcagcggtgaaaaaagtgggtgttcttggtggcggctta
atgggcgctgggatcagtcatgtaacggtagcaaaagcaaaagtgcctgttcgaatcaaa
gatgtgagcaatgacggtgtattgaatgcgcttaactacaactacaagttgtttgagaag
cagcgcaaacgtcgcatcctgtcgaaagccgatttacaggcgaagatgttgcaactgtca
ggtggcgtagactttacaagttacaaccacattgatgttgtgatcgaagcggttttcgaa
gacttggatctaaaacaacagatggttgcggacattgaagcaaacgcaaaatctgaaact
atttttgctacgaacacgtcttcgttaccaatccacaagattgcagaaaaggcagagcga
ccagaaaacatcgtcggtttacattactttagcccagtagaaaaaatgccgctggtggaa
gtgattccgcatgaaacaacgtctgatgaaaccatttcgacagttgtcgcattggctaag
aaacagggtaaaaccccaatcgttgtgaaggacaaagctggcttttacgtaaaccgcatt
cttgcgccttacatgaatgaagctgcgcatatcttgctggcaaatgagccgattgagaag
ttagatggtgcgttgttggatttcggcttccctgttgggccaatcacgttacttgatgaa
gttggtgttgatattggtgcgaagatcatgccgattctagtcaatgagttgggcgaacga
ttcaaaggtcctgatgtattcgatatcttattgaatgacggtcgcaaaggacgcaagagc
gggaaaggtttctacacttacaaaggtaagaagaaagaagtcgataaatccatctacaag
ctactcaaactgacgccagaatcgaagctcagcgataacgatattgcgttgcgctgtgta
ctgccaatgcttaatgaagcagtacgatgcttggacgacggtattattcgctctccgcgc
gatggcgatattggtgcgatttttggtattggcttccctccattccttggcgggccattc
cgttatatggatcaattcggtttgaaagaactggttgagaaaatgaacgaatttgcatcg
aaatatggcgatcgttatgcgccatgcgacggactgctgactagagcgggtgaaggtcgt
accttctactaa

DBGET integrated database retrieval system