KEGG   Vibrio parahaemolyticus BB22OP: VPBB_2128Help
Entry
VPBB_2128         CDS       T02409                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
vpb  Vibrio parahaemolyticus BB22OP
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:vpb00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2362059..2363264)
Genome map
AA seq 401 aa AA seqDB search
MQKLTILGATGSIGASTLKVVEQNPELFSVVALAAGTNVEKMVALCRQWQPKFAVMADKA
AAVALQSEIHTISPNTEVLGGVDALCHVASLEEVDSVMAAIVGAAGLLPTMAAVKAGKRV
LLANKEALVMSGQLFIDAVEQYGAELLPVDSEHNAIFQCLPQQVQTNLGRCNLDEHGISS
ILLTGSGGPFRYADIADLDSVTPAQAIAHPNWSMGPKISVDSATMMNKGLEYIEAKWLFN
AARDQLKVIIHPQSVIHSMVQYRDGSVLAQMGEPDMATPIALTMSYPSRVDAGVKPLDFT
QVGELTFLQPDFARYPCLKLAIDACYEGQHATTALNAANEVAVDAFLNNRLGFTDIARIN
ELVLHKITASCKPENANSLESLLELDRMSRTIALEIIRERS
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaagttaacgattcttggtgcaacaggctcaataggtgcaagcaccttaaaagtg
gttgaacaaaacccagagctgttttctgtggtcgcactagcggctggcactaacgttgaa
aagatggtggcactttgtcgccaatggcagcctaaattcgcggtaatggcggataaggct
gcggctgttgctctgcaatcagaaatccacaccatttcaccaaatacagaagtgttaggt
ggtgttgatgcactttgtcatgtggcttcattagaagaagtagatagcgtaatggcagcc
atcgttggggctgcgggtttgttgccaaccatggcggccgttaaagcgggtaagcgcgta
ttgctggcgaataaagaagctcttgtcatgtctggacagttgtttattgatgccgttgaa
caatacggggcagagttgctgccagtagacagtgaacataatgctattttccagtgccta
ccacagcaagttcaaaccaatcttggccgctgtaacttagatgagcatggcatttctagt
attctgttaaccggatctggcggtccattccgttacgctgacattgccgatctcgacagc
gtaacgccagcacaggcaatcgcgcaccctaactggtctatggggccaaagatttcggtc
gattctgcgactatgatgaataaaggtcttgagtacattgaagcaaaatggctattcaat
gcggctcgtgaccagttaaaagtgattattcacccgcaatccgtgatccattcaatggtt
cagtatcgtgatggttcggtactggcgcaaatgggagagccagatatggcaacaccaatt
gcgttgacaatgtcttatccttctcgtgttgatgccggtgtaaaaccgctagactttact
caagtaggtgaattgacattcttgcaaccagactttgctcgttatccttgtttgaagctt
gcgattgacgcgtgttacgaagggcaacatgcgactactgctctaaatgcagccaatgaa
gttgctgttgatgcgtttctaaataatcgccttggttttacagatatagctcgcatcaat
gaattggttttgcataaaatcaccgcaagctgcaaacctgagaatgcgaatagcttggaa
agcttgctagagctagatagaatgtctcgaactatcgccctagaaattatacgcgagcgt
agctaa

DBGET integrated database retrieval system