KEGG   Vibrio parahaemolyticus BB22OP: VPBB_2202Help
Entry
VPBB_2202         CDS       T02409                                 

Definition
Exodeoxyribonuclease V alpha chain
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
vpb  Vibrio parahaemolyticus BB22OP
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:vpb03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2445358..2447505)
Genome map
AA seq 715 aa AA seqDB search
MTTNHNLHSGQDSLLVVLERLAHKGAIRQLDYQFACFIDSQTHDEQSDSQALAFIAGVVS
SELGKGHICLPLFDAQGQSTDLASKLGLFGESALALNTQLQGIDWIQVLQNSSLVGAQGE
ALPLMFDGERLYLHRYWHYEVTLAEKLNHLGAAVNLQPQEFARLSELLNHLFARQYHFLF
NALGKAVEAGSSNQVLRQQLVCDHLDVVASESLDWHAIDSVLSNARKVQDLQTLNELVPL
SACVNWQKVAAAVALTRRFAVISGGPGTGKTTTVTKLLAALIEQATHEKNLTIKLVAPTG
KAAARLTESIGKAVQELPVSPELKAKIPTESSTLHRLLGAIPNSAEFRHNKQNPLHLDIL
VIDEASMVDLPMMYKVVDALPKHARLILLGDKDQLASVEAGAVLGDICSFHALGYGKEQA
SAIAKLTGFDTLAHTGNSASSIADSLCMLQKSYRFDARSGIGQLAKAVNSGSAASVDNVW
ARDFSDIEHFALSSQHYNQMMQTLVQEYGRYLKRIGQQEIDPKTGEPESLTHKAKAVLET
FNQCRLLCAIREGDFGVAGLNQRIEKALAARKFIQVQDEIWYHGRPVMVTRNDHGLGLYN
GDIGICMRDDTEEEPRLKVFFELPDGSVKSVLPSRVPEHETAYAMTIHKSQGSEFDYTLM
ILPPDFSPILTRELIYTGITRAKKRLALYAELNVLKRGIKVKTTRASGLVQRLTN
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atgacgacaaatcacaatcttcattctggccaagatagtttattggtagtgctggaacgc
ttggcgcacaaaggtgctattcgtcagctcgactaccaattcgcctgttttattgattct
caaacgcatgatgaacagtcggacagtcaagcattggcgtttatcgcgggtgttgtcagt
agtgagctcggcaaaggacatatctgtctgcctctgttcgatgcacaagggcaatctacg
gatttggctagtaagttagggctgtttggtgagtcggcattggcgcttaatactcagctt
caaggtatagactggattcaagtattacaaaattccagcttggtcggcgcgcaaggagaa
gccttgccgttgatgttcgatggcgagcgtctgtatctgcaccgctattggcattatgaa
gtgactctggcggaaaagcttaatcacttgggcgccgcagttaacttgcaaccacaagag
tttgcgcgattatccgagttgctcaaccatttatttgcacgccaataccattttctgttt
aacgcgttaggcaaagcagtagaagcgggaagcagcaaccaagtgttgcgtcaacaattg
gtgtgtgaccaccttgatgtggtcgcaagcgaatcgttggattggcacgccattgattcc
gtgcttagcaatgcgcgcaaggttcaggacttgcaaacactgaatgaacttgtgccactc
tcggcttgcgtgaactggcaaaaagtcgcggcggcagttgcgttaactcgtcgatttgct
gtgatttctggtggcccaggtacgggtaaaacgacgacggtaaccaaattgcttgccgct
ttgattgaacaggcgacgcacgagaaaaatctaaccatcaagctggtggccccgacgggg
aaagcggcggcgcgattaaccgagtccattggtaaagcagtgcaagagctgccagtttct
ccggagctaaaagccaaaattccgactgaatcgagtaccttacataggttgctgggcgcg
attcctaatagcgcagaatttcgtcacaacaagcaaaatccactgcatttggatattttg
gttatcgacgaagcgtcgatggtcgatttaccaatgatgtacaaagtggtcgatgcctta
ccgaagcatgcgcggctgattttgttaggtgataaagaccaacttgcctcagttgaagca
ggggctgtgttgggtgatatctgttcgttccatgcattgggttatggcaaagagcaggcg
tcagccatcgcaaaactgacggggttcgatactttagcgcatacgggtaacagtgcatct
agcattgctgatagtttatgtatgctgcaaaagagttaccgatttgatgctcgctcaggc
attggtcagttggcaaaagcggttaactccggttctgctgcgagcgtagataacgtctgg
gcgcgtgacttttccgatatcgaacatttcgccctaagtagtcaacattacaaccaaatg
atgcagacgttggtgcaggaatacggtcgttacctcaaacgcattggacaacaggaaatc
gatcctaaaaccggagagccagagtcgctaacgcacaaagccaaagcagtgttagagact
ttcaaccaatgccggctgctgtgcgcgatccgtgaaggtgactttggtgtggctgggcta
aaccaacgcatcgagaaagcgctcgcggcgcgcaagttcattcaagttcaggatgaaatt
tggtatcacggcagacccgtcatggttacgcgtaatgatcacggtttaggtttgtataac
ggtgatatcggtatttgtatgcgagatgacactgaagaagaaccgcgtttgaaagtcttt
ttcgagttacctgacggcagtgtgaaatcggtcttgccaagtcgagtacctgaacatgaa
acggcttacgccatgaccatccataaatcgcaaggcagtgaatttgattacacccttatg
attttgccaccagactttagcccgatattaacccgtgagttgatttacacaggcattacc
cgcgcgaaaaagcgcttagctctttatgccgagctcaatgttctgaagcgaggcattaag
gtgaaaacgactcgtgcgagtgggctagtacagcggcttactaactaa

DBGET integrated database retrieval system