KEGG   Vibrio parahaemolyticus BB22OP: VPBB_2214Help
Entry
VPBB_2214         CDS       T02409                                 

Definition
Glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
vpb  Vibrio parahaemolyticus BB22OP
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vpb00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    VPBB_2214
Enzymes [BR:vpb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     VPBB_2214
Exosome [BR:vpb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   VPBB_2214
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:2465307..2466824
Genome map
AA seq 505 aa AA seqDB search
MTEQKYIVALDQGTTSSRAVILDHDANIVSVAQREFTQIYPQAGWVEHDPMEIWATQSST
LVEALAKSGIRSDQLAAIGITNQRETTIVWNKETGKPVYNAIVWQCRRTADICEDLKSRD
LEDYVRDNTGLVLDPYFSGTKVKWILDNVEGAREDAEAGKLLFGTVDTWLVWKMTQGRVH
VTDYTNASRTMLFNINDLCWDQKLLDEMGIPASMMPEVKRSSEIYGKTNIGGKGGTRIPI
AGIAGDQQAALYGQMCVEAGQAKNTYGTGCFLLMNTGQEKVTSKNGLLTTLACGPKGEPA
YALEGAVFMGGASIQWLRDELKILNGAEDSEYFATKVDTSNGVYVVPAFTGLGAPYWDAY
ARGTIVGLTRGVNSNHIIRATLEGIAYQTRDVLDAMQADSGIKLANLRVDGGAVANNFLM
QFQSDVLNTEVHRPQVTEVTALGAAYLAGLAVGYWNSIDELQDKAVLDRTFEPHDDEEKR
NRRYKGWKRAVKCAQTWSELHDEDD
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgactgagcaaaaatacattgttgccctcgaccaaggtacgacaagctctcgcgctgtt
attcttgatcacgacgccaatatcgtaagcgtcgctcagcgagagtttactcagatttat
ccacaagcaggttgggttgagcacgatccaatggaaatctgggcaacacaaagctctaca
ttagttgaagctttggctaagtcaggcatccgaagcgaccaattagctgctattggtatt
acgaaccaacgtgaaaccaccatcgtctggaacaaagaaacaggcaaacccgtctacaac
gcgatcgtatggcaatgtcgtcgcaccgcagacatttgtgaagacctaaaaagccgcgac
ttagaagattacgttcgcgacaacaccggcttggtgcttgacccttacttctctggcact
aaagtgaagtggattctggataacgtagaaggcgcacgcgaagatgcagaagcaggtaaa
ctgctgtttggtaccgtcgatacgtggttagtatggaagatgactcaaggccgcgttcac
gttactgactacaccaacgcatcacgtaccatgctgtttaacatcaacgacctatgttgg
gaccaaaagctgttggatgagatgggcattccagcgtcaatgatgccagaagtaaaacgc
tcttcggaaatttacggcaaaacgaacatcggtggtaaaggcggtactcgtattcctatc
gcagggattgcaggtgaccaacaagcggcgttatacggccaaatgtgtgtggaagctggc
caagcgaaaaacacatacggcacaggttgtttcttgctgatgaacactggccaagagaaa
gtcacctcgaagaatggtctgcttaccacactagcttgtggcccgaaaggcgagccagct
tacgcacttgaaggtgcagtgttcatgggtggtgcctctatccagtggctacgtgacgaa
ctgaaaatcctaaacggcgcagaagactctgaatacttcgcaacaaaagtggacacatcg
aacggcgtttatgtagtaccagcctttactggccttggcgctccatactgggatgcttac
gcacgtggcaccattgttggccttactcgcggtgtgaactcaaaccacattatccgcgcg
actctggaaggcatcgcttaccaaactcgtgacgtattggatgcgatgcaagctgactct
ggaatcaagctcgcaaacttgcgtgttgatggcggtgcggtagcaaacaacttcctaatg
caattccaatcggatgtattaaacacagaagtacatcgtccacaagtgactgaagtaacg
gctcttggagctgcatacctggcaggtttagcggttggttactggaacagcattgatgag
ctgcaagataaagcagtgcttgatcgtacgtttgaaccgcatgatgacgaagaaaaacgc
aaccgtcgttacaaaggttggaaacgcgctgtaaaatgtgcgcaaacttggtctgaactg
cacgacgaagacgattaa

DBGET integrated database retrieval system