KEGG   Vibrio parahaemolyticus BB22OP: VPBB_2261Help
Entry
VPBB_2261         CDS       T02409                                 

Definition
Thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
vpb  Vibrio parahaemolyticus BB22OP
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vpb00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    VPBB_2261
Enzymes [BR:vpb01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     VPBB_2261
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2521511..2522839)
Genome map
AA seq 442 aa AA seqDB search
MYLPQEIIRKKRDGEVLTADEINFFIQGVANNTVSEGQIAAFAMTIFFNEMTMDERIALT
CAMRDSGMVIDWSHMNFGGPIVDKHSTGGVGDVTSLMLGPMVAACGGFVPMISGRGLGHT
GGTLDKLEAIPGYNITPTNEVFGQVTKDAGVAIIGQTGDLAPADKRVYATRDITATVDNI
SLITASILSKKLAAGLESLVMDVKVGSGAFMPTYEASEELAKSIVAVANGAGTKTTAILT
DMNQVLASSAGNAVEVREAVRFLTGEYRNPRLLEVTMASCAEMLVLGKLAENTDDARAKL
MEVLDNGKAAACFGKMVAGLGGPADFVENYDNYLEKAEIIKPVYATETGIVSAMDTRAIG
MAVVSMGGGRRVATDEIDYAVGFDNFIRLGEVADSDKPLAVIHARSEEQWEEAAKALRSA
IKVGGEYTPTPEVYRQIRAEDI
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgtatttaccacaagaaatcattcgtaaaaaacgtgacggcgaagtcctaacagccgac
gaaatcaacttctttattcaaggcgtagcgaacaacacggtatctgaaggtcagattgcg
gcgtttgctatgacgattttctttaatgaaatgaccatggatgagcgcatcgccctaacg
tgtgcaatgcgtgactcaggcatggtaatcgactggagccacatgaacttcggtggtcca
attgtcgacaaacactcaaccggtggtgtgggtgacgtaacttctctgatgcttggccct
atggtggcagcatgtggcggtttcgtacctatgatctctggtcgtggccttggccacaca
ggcggcacgctagataaacttgaagcgattcctggctacaacatcacaccaacgaacgaa
gtttttggtcaagtaaccaaagatgcgggtgtggcgatcatcggtcaaacgggcgatctt
gctccggcagataagcgcgtgtacgcgactcgtgatatcacggctaccgtagacaacatc
tcactgatcacggcatcgatcctgtctaagaaattggcagcgggtctggaatctctagtg
atggacgtaaaagtcggttctggcgcatttatgccaacttacgaagcgtctgaagagcta
gcaaaatctatcgttgctgtagcaaatggtgcaggcacgaagactacggcgatccttacg
gacatgaaccaagtactggcttcttctgcgggtaacgcggtggaagttcgtgaagcggtt
cgtttcctaacaggtgaataccgcaacccgcgtctacttgaagtgacgatggcatcatgt
gctgaaatgctcgtgcttggcaaactggctgagaacacagacgacgcacgcgcgaaactg
atggaagtgctagacaacggtaaagcagcagcttgcttcggcaaaatggttgcgggtctt
ggcggtccagctgacttcgtagaaaactacgacaactacctagaaaaagcagaaatcatc
aagccagtttacgcgacagaaacaggcattgtctctgcaatggacacgcgtgctatcggc
atggctgtggtttctatgggtggcggtcgccgtgttgcaactgatgaaatcgactacgcg
gtaggttttgataacttcatccgattgggtgaagttgctgatagcgataaacctctagca
gttatccacgctcgcagtgaagagcagtgggaagaagcggcaaaagcactacgcagtgca
atcaaagtgggtggtgaatatacaccaactccagaggtttaccgtcaaattcgtgcagaa
gacatctaa

DBGET integrated database retrieval system