KEGG   Vibrio parahaemolyticus BB22OP: VPBB_2312Help
Entry
VPBB_2312         CDS       T02409                                 

Definition
Beta-N-acetylhexosaminidase, (GlcNAc)2 catabolism
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
vpb  Vibrio parahaemolyticus BB22OP
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:vpb00520]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:vpb00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:2583579..2585498
Genome map
AA seq 639 aa AA seqDB search
MEYRVDLVVLSEQKQNCRFGLTFHNLSDQDLHNWSLIFAFDRYILPDSISNGQLKQIGSY
CTLKPEGLVLAANHHFYCEFSIGSNPFRYYSDGFNEALVNFEVNGNLQRAQVDVTPIVLA
SPYRERSEIPSSLTHAQPLLPKPNHIEVSDHCFSFNHHAGVAVYSNLANSAKEWLLEELK
RIHQFEFASDNGSQIIFKGNPTLDEGAYKLKVAEESIKIEAGSSSGFTHACATLLQLIKV
GDQPASMEVVCCSIKDRPRFRYRGMMLDCARHFHSVEQVKRLINQLAHYKFNTFHWHLTD
DEGWRIEIKSLPQLTDIGAWRGLDETNEPQYTHLAERYGGFYTQEDIKDVVAFASKRGIT
VIPEIDVPGHCRAAIKSLPHLLVEAEDTTEYRSIQHYNDNVINPALPGSYEFIDKVLEEV
SALFPAPYVHIGADEVPNGVWSKSPACQALMEQLGYSDYKELQGHFLRHAEDKLRKLGKR
MLGWEEAQHGDKVSKDTVIYSWLSEEAALNCARQGFDVVLQPAQTTYLDMTQDYAPEEPG
VDWANPLPLEKTYNYEPLAEVPADDPIRKRIWGIQTALWCEIINNQSRMDYMVFPRLTAM
AEACWTDKQHRDWTDYLSRLKGHLPLLDLQGVNYRKPWK
NT seq 1920 nt NT seq  +upstreamnt  +downstreamnt
atggaatatcgtgttgatctcgtcgtcctatcagaacaaaagcaaaactgccgtttcgga
ctgactttccataatttgagcgatcaagatctccacaattggagcctgatttttgctttt
gatcgctacattctgccggatagtatttcgaatggtcagctcaagcaaattggcagctac
tgcaccctcaaaccagaagggttggtgctggcagctaaccatcatttttactgcgagttc
agtattggttcgaacccattccgttactattctgatggattcaatgaagccttggtcaac
tttgaagtcaacggcaaccttcagcgagctcaagtcgatgtcacgccgatcgtattggct
tcaccgtaccgtgaacgtagtgagatcccttccagcttgacgcatgcgcagcctttgttg
ccaaaaccaaaccatatagaagtcagcgatcactgctttagctttaatcatcacgccggc
gttgcggtttattcaaacctagccaattcagctaaagagtggttacttgaagagcttaag
cgcattcatcaatttgagttcgcatcagacaatggcagtcagatcatcttcaaaggcaac
ccaaccttggatgaaggcgcttacaagctgaaggtagcagaagagtcgatcaaaattgaa
gcaggctcttcgtctggttttacccatgcttgtgcaacgttattgcaactgatcaaagtt
ggcgatcaaccagcctcaatggaagtggtttgctgttcaatcaaagaccgaccacgtttt
cgttaccgcggtatgatgctagattgtgctcgccattttcactccgttgagcaagtcaaa
cgtttgatcaaccagttggctcactacaagttcaatacattccattggcaccttaccgat
gatgaaggttggcgaattgagatcaaatcattgcctcaactaaccgatattggcgcatgg
cgtgggttggatgaaaccaatgagccacagtacacgcaccttgctgagcgttacggcggt
ttttacactcaagaagacatcaaagacgtggttgcatttgcttctaaacgaggcatcact
gttatccctgaaatcgatgtaccaggccactgccgagctgccatcaagtcgttaccacac
ctattggtagaagcagaagataccactgaataccgcagcattcagcattacaacgacaat
gtcattaacccagctctgccggggagctatgagtttatcgataaagtgttggaagaagtc
tccgcgttgttccctgccccttatgtccatatcggtgcggatgaagtacctaacggcgta
tggtcaaaaagcccagcgtgccaagcactaatggaacaactgggttacagcgactacaaa
gagttacaagggcacttcttgcgtcatgccgaagacaaactgcgcaaacttggcaagcgc
atgctgggttgggaagaagcacagcatggcgacaaagtcagcaaagacacagtgatctat
tcgtggctaagcgaagaagcggcgttgaactgcgcgcgccaaggtttcgatgtggtgcta
caaccagcgcaaaccacctacctagatatgacccaagattacgcaccagaagaaccgggc
gtggattgggctaacccgttgccgctagaaaaaacttacaactatgaaccactcgctgaa
gtgccagccgacgatccaatacgtaaacgcatttggggcattcaaaccgcattgtggtgt
gaaatcatcaacaaccagtctcgtatggactacatggtcttcccgcgcttaaccgcaatg
gcagaagcatgttggacagacaaacaacaccgagactggaccgactatttatcacgtttg
aaaggacacctaccgctgcttgatttgcagggagtgaattaccgtaaaccgtggaagtaa

DBGET integrated database retrieval system