KEGG   Vibrio parahaemolyticus BB22OP: VPBB_2312Help
Entry
VPBB_2312         CDS       T02409                                 

Definition
Beta-N-acetylhexosaminidase, (GlcNAc)2 catabolism
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
vpb  Vibrio parahaemolyticus BB22OP
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vpb00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    VPBB_2312
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    VPBB_2312
Enzymes [BR:vpb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     VPBB_2312
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:2583579..2585498
Genome map
AA seq 639 aa AA seqDB search
MEYRVDLVVLSEQKQNCRFGLTFHNLSDQDLHNWSLIFAFDRYILPDSISNGQLKQIGSY
CTLKPEGLVLAANHHFYCEFSIGSNPFRYYSDGFNEALVNFEVNGNLQRAQVDVTPIVLA
SPYRERSEIPSSLTHAQPLLPKPNHIEVSDHCFSFNHHAGVAVYSNLANSAKEWLLEELK
RIHQFEFASDNGSQIIFKGNPTLDEGAYKLKVAEESIKIEAGSSSGFTHACATLLQLIKV
GDQPASMEVVCCSIKDRPRFRYRGMMLDCARHFHSVEQVKRLINQLAHYKFNTFHWHLTD
DEGWRIEIKSLPQLTDIGAWRGLDETNEPQYTHLAERYGGFYTQEDIKDVVAFASKRGIT
VIPEIDVPGHCRAAIKSLPHLLVEAEDTTEYRSIQHYNDNVINPALPGSYEFIDKVLEEV
SALFPAPYVHIGADEVPNGVWSKSPACQALMEQLGYSDYKELQGHFLRHAEDKLRKLGKR
MLGWEEAQHGDKVSKDTVIYSWLSEEAALNCARQGFDVVLQPAQTTYLDMTQDYAPEEPG
VDWANPLPLEKTYNYEPLAEVPADDPIRKRIWGIQTALWCEIINNQSRMDYMVFPRLTAM
AEACWTDKQHRDWTDYLSRLKGHLPLLDLQGVNYRKPWK
NT seq 1920 nt NT seq  +upstreamnt  +downstreamnt
atggaatatcgtgttgatctcgtcgtcctatcagaacaaaagcaaaactgccgtttcgga
ctgactttccataatttgagcgatcaagatctccacaattggagcctgatttttgctttt
gatcgctacattctgccggatagtatttcgaatggtcagctcaagcaaattggcagctac
tgcaccctcaaaccagaagggttggtgctggcagctaaccatcatttttactgcgagttc
agtattggttcgaacccattccgttactattctgatggattcaatgaagccttggtcaac
tttgaagtcaacggcaaccttcagcgagctcaagtcgatgtcacgccgatcgtattggct
tcaccgtaccgtgaacgtagtgagatcccttccagcttgacgcatgcgcagcctttgttg
ccaaaaccaaaccatatagaagtcagcgatcactgctttagctttaatcatcacgccggc
gttgcggtttattcaaacctagccaattcagctaaagagtggttacttgaagagcttaag
cgcattcatcaatttgagttcgcatcagacaatggcagtcagatcatcttcaaaggcaac
ccaaccttggatgaaggcgcttacaagctgaaggtagcagaagagtcgatcaaaattgaa
gcaggctcttcgtctggttttacccatgcttgtgcaacgttattgcaactgatcaaagtt
ggcgatcaaccagcctcaatggaagtggtttgctgttcaatcaaagaccgaccacgtttt
cgttaccgcggtatgatgctagattgtgctcgccattttcactccgttgagcaagtcaaa
cgtttgatcaaccagttggctcactacaagttcaatacattccattggcaccttaccgat
gatgaaggttggcgaattgagatcaaatcattgcctcaactaaccgatattggcgcatgg
cgtgggttggatgaaaccaatgagccacagtacacgcaccttgctgagcgttacggcggt
ttttacactcaagaagacatcaaagacgtggttgcatttgcttctaaacgaggcatcact
gttatccctgaaatcgatgtaccaggccactgccgagctgccatcaagtcgttaccacac
ctattggtagaagcagaagataccactgaataccgcagcattcagcattacaacgacaat
gtcattaacccagctctgccggggagctatgagtttatcgataaagtgttggaagaagtc
tccgcgttgttccctgccccttatgtccatatcggtgcggatgaagtacctaacggcgta
tggtcaaaaagcccagcgtgccaagcactaatggaacaactgggttacagcgactacaaa
gagttacaagggcacttcttgcgtcatgccgaagacaaactgcgcaaacttggcaagcgc
atgctgggttgggaagaagcacagcatggcgacaaagtcagcaaagacacagtgatctat
tcgtggctaagcgaagaagcggcgttgaactgcgcgcgccaaggtttcgatgtggtgcta
caaccagcgcaaaccacctacctagatatgacccaagattacgcaccagaagaaccgggc
gtggattgggctaacccgttgccgctagaaaaaacttacaactatgaaccactcgctgaa
gtgccagccgacgatccaatacgtaaacgcatttggggcattcaaaccgcattgtggtgt
gaaatcatcaacaaccagtctcgtatggactacatggtcttcccgcgcttaaccgcaatg
gcagaagcatgttggacagacaaacaacaccgagactggaccgactatttatcacgtttg
aaaggacacctaccgctgcttgatttgcagggagtgaattaccgtaaaccgtggaagtaa

DBGET integrated database retrieval system