KEGG   Vibrio parahaemolyticus BB22OP: VPBB_2340Help
Entry
VPBB_2340         CDS       T02409                                 

Definition
Dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
vpb  Vibrio parahaemolyticus BB22OP
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:vpb01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:vpb00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:vpb00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:vpb00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2621081..2622967)
Genome map
AA seq 628 aa AA seqDB search
MAIEINVPDIGADEVEVTEILVSVGDKVEEEQSLITVEGDKASMEVPASQAGIVKEIKVA
EGDKVSTGSLIMIFEAEGAADAAPAPAAEAAPAAAPAPAAAAELKEVHVPDIGGDEVEVT
EIMVAIGDSIEEEQSLITVEGDKASMEVPAPFAGTLKEIKVAAGDKVSTGSLIMVFETAG
SGAPAAPAAVEAPAAAAPAASAAKEVNVPDIGGDEVEVTEIMVAVGDTVEEEQSLITVEG
DKASMEVPAPFAGTVKEIKIAAGDKVSTGSLIMVFEVAGAAPAPVAAPAQAAAPAAAAPK
AEAPAAAAPAATGDFKENDEYAHASPVVRRLAREFGVNLSKVKGSGRKSRILKEDVQNYV
KEALKRLESGAAASGKGDGAALGLLPWPKVDFSKFGETEVQPLSRIKKISGANLHRNWVM
IPHVTQWDNADITALEAFRKEQNAIEAKKDTGMKITPLVFIMKAAAKALEAFPAFNSSLS
EDGESLILKKYVNIGIAVDTPNGLVVPVFKDVNKKGIYELSEELMAVSKKARAGKLTAAD
MQGGCFTISSLGGIGGTAFTPIVNAPEVGILGVSKSEMKPVWNGKEFEPRLQLPLSLSYD
HRVIDGAEGARFITYLNSCLSDIRRLVL
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
atggcaatcgaaattaatgtaccagacatcggtgcggatgaggttgaagttactgagatt
cttgtaagcgttggcgacaaggttgaagaagaacagtctctgatcactgttgaaggcgat
aaagcttctatggaagttcctgcttctcaagcgggtatcgttaaagaaatcaaagttgca
gaaggcgacaaggtttctactggttctctaatcatgattttcgaagccgagggtgcagct
gacgctgcacctgctcctgcggcagaagcggctccagcagcggctccagctccagcagca
gcggcagaactgaaagaagttcacgtaccagacatcggtggtgacgaagttgaagttact
gaaatcatggtagcaatcggcgacagcatcgaagaagagcaatctctgatcactgtagaa
ggcgacaaagcttctatggaagttcctgcaccattcgcaggtacgcttaaagagatcaaa
gtagctgcaggcgataaagtatcgactggctctctaatcatggtattcgaaactgcaggt
tcaggtgctccagcagctcctgcggcagttgaagctccagcggcagcagctccagcagca
tctgcggcgaaagaagttaacgttccagatatcggcggcgacgaagttgaagtgactgaa
atcatggttgcagttggcgacacagtggaagaagagcaatctctgatcactgtagaaggc
gacaaagcttctatggaagttcctgcaccattcgctggtacagttaaagaaatcaagatt
gcagctggcgacaaagtgtctactggctcactaatcatggtattcgaagtagcgggcgcg
gcacctgctccggtagcggctccagctcaagcagcagcacctgcagcggcagctcctaaa
gcagaagctccagcggcagcagctccagcagcgactggcgatttcaaagagaacgatgag
tacgctcacgcgtctccagttgttcgtcgtctagctcgtgagttcggtgtaaacctttct
aaggttaaaggttctggtcgtaagagccgtatcctgaaagaagacgttcagaactacgtg
aaagaagcgcttaagcgtcttgagtctggtgcagcagcatctggcaaaggcgacggtgca
gctcttggtctactaccatggccaaaagtggacttcagcaagttcggtgagacagaagtt
caaccgctatctcgcattaagaagatctctggtgctaacctacaccgtaactgggtaatg
atcccgcacgttacacagtgggataacgcagacatcacggctcttgaagcattccgtaaa
gagcaaaacgcgattgaagcgaagaaagacactggcatgaagatcactccactagtgttc
atcatgaaagcggcggctaaagcacttgaagcgttcccagcgttcaactcttctctatca
gaagacggtgagagcctaattctgaagaaatacgtgaacatcggtatcgcggtagatacg
ccaaacggtctagttgttcctgtatttaaagacgtgaacaagaaaggcatctacgagcta
tctgaagagcttatggctgtttctaagaaagctcgtgctggcaagctaactgctgctgac
atgcaaggtggctgtttcactatctctagcctaggcggtatcggcggtacggcgtttact
ccaatcgtaaacgcgccagaagttggtatcctaggtgtgtctaagtcagaaatgaaacct
gtatggaacggtaaagagttcgaaccgcgtctacaacttccactgtctctatcatacgac
caccgtgtgatcgatggtgctgaaggtgcgcgcttcatcacttacctaaattcatgtcta
tctgacattcgtcgtctagttctttaa

DBGET integrated database retrieval system