KEGG   Vibrio parahaemolyticus BB22OP: VPBB_2379Help
Entry
VPBB_2379         CDS       T02409                                 

Definition
Protein-L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
vpb  Vibrio parahaemolyticus BB22OP
Brite
Enzymes [BR:vpb01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     VPBB_2379
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2665576..2666202)
Genome map
AA seq 208 aa AA seqDB search
MSNPHADRLIAFLISSGIKDQRVLDAMHCLPRESFVSQAMMHQAYDNNALPIGQGQTISQ
PYIVARMTELLELQRASNVLEIGTGSGYQTAVLAQIVDHVYSVERIKSLQWEAKRRLKQL
DIYNVSTKHGDGWLGWETKGPFDAIIVTAAAEVIPQALLSQLKDGGKMVIPVGDAEQQLL
RIERKGDEYLSTVVEMVRFVPLVAGDLA
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgagtaacccacatgctgacaggttgatagcgtttcttatctccagtggcatcaaagat
caacgcgttttggatgcaatgcattgtttaccgagagagagctttgtttctcaagcgatg
atgcaccaagcctacgataacaatgcgctaccgattggtcagggacaaactatttctcaa
ccttacatcgtcgctcgcatgaccgagctgcttgagcttcaacgtgctagtaacgttttg
gaaatcggaaccggttctgggtaccaaaccgcagttttagcacaaatcgttgaccatgtt
tattccgttgaacgcatcaaatctttgcaatgggaagcgaaacgtcgtcttaagcaactt
gatatttacaatgtctcgacgaagcatggtgatggctggttaggatgggaaacgaaaggt
ccgtttgacgccatcattgttaccgctgctgcagaagtgattccccaagcgcttctctca
cagttaaaagatggcggtaaaatggtgattcctgtcggagatgctgagcagcaactactt
agaattgaacgcaagggtgacgagtacctttctaccgttgtggaaatggttcgctttgtt
cctcttgtcgcgggtgatttggcttaa

DBGET integrated database retrieval system