KEGG   Vibrio parahaemolyticus BB22OP: VPBB_2474Help
Entry
VPBB_2474         CDS       T02409                                 

Definition
Aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
vpb  Vibrio parahaemolyticus BB22OP
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Brite
KEGG Orthology (KO) [BR:vpb00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    VPBB_2474
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    VPBB_2474
Enzymes [BR:vpb01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     VPBB_2474
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:2772800..2773729
Genome map
AA seq 309 aa AA seqDB search
MANSLYQKHIISIPELSREELELIVETAGNLKKEPRPELIKNKVVASCFFEPSTRTRLSF
ETAIQRIGGDVIGFDNDGNTSLAKKGETLSDSVQVISSYVDAFVMRHPQEGAARLASEFS
NGVPVINAGDGANQHPTQTLLDLYTIAETQGRLDNLNVAFVGDLKYGRTVHSLTQALAKF
NNIRFYFVAPDALAMPEYICEELDEAGIEYSLHTEMEAVIPELDILYMTRVQKERFDESE
YAHIKSAYILTAALLEGARENLKVLHPLPRVDEITTDVDKTPHAYYFQQAQNGVYARQAL
LALVLNETL
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggcgaactcgctttaccagaagcacatcatctctattccagagctttctcgtgaagag
ctggaacttatcgtcgaaactgcaggtaatctgaaaaaggaacctcgaccagaactgatt
aaaaacaaagtcgttgcgagctgtttctttgagccatcaacgcgtactcgcttgtcgttt
gagaccgcgattcaacgcattggtggtgatgtcattggttttgataacgatggtaatacg
tctctggcgaagaaaggggaaacgctttctgattctgtacaagttatctcttcatacgtc
gatgcatttgtgatgcgccaccctcaagaaggtgcagcgcgccttgcttccgagttttcg
aatggcgttccagtgattaacgcgggcgacggtgctaaccaacacccaactcaaactctg
cttgacctctacactatcgcggaaacgcaaggtcgcttagacaacctaaacgtggcattt
gtcggcgatttaaaatacggccgcaccgttcactcactgactcaagcactggcgaagttc
aataacatccgcttctactttgtcgctccagacgcattggcgatgccagagtacatctgc
gaagaactcgatgaagctggcattgaatacagcctacacacagagatggaagcggtaatt
cctgagctcgatattctttacatgactcgcgttcaaaaagagcgttttgacgagtctgaa
tatgcgcacatcaaatcggcttacattctgacggcggctctattggaaggcgcgcgtgaa
aatctaaaagtcctgcacccgctacctcgtgttgatgaaatcacgacagacgtagataaa
accccacacgcgtactacttccagcaggcacaaaatggcgtgtacgctcgccaagcgctg
ttggctttggttctaaacgaaacactgtaa

DBGET integrated database retrieval system