KEGG   Vibrio parahaemolyticus BB22OP: VPBB_2531Help
Entry
VPBB_2531         CDS       T02409                                 

Definition
UTP--glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
vpb  Vibrio parahaemolyticus BB22OP
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:vpb00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    VPBB_2531
   00052 Galactose metabolism
    VPBB_2531
   00500 Starch and sucrose metabolism
    VPBB_2531
   00520 Amino sugar and nucleotide sugar metabolism
    VPBB_2531
Enzymes [BR:vpb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     VPBB_2531
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:2832407..2833279
Genome map
AA seq 290 aa AA seqDB search
MIKKCLFPAAGYGTRFLPATKSMPKEMMPVVNKPLIEYGVEEAIQAGMNGMCIVTGRGKH
SIMDHFDKNYELEHQISGTNKEELLVDIREIIESANFTYIRQREMKGLGHAILTGRELVG
DEPFAVVLADDLCVNEEEGVLAQMVALFKQFRCSIVAVQEVPADETHKYGVISGEMIKDD
IYRVDDMVEKPEPGTAPSNLAIIGRYILTPDIFELIENTEPGKGGEIQITDALLKQAKAG
CVLAYKFKGKRFDCGSVEGYIEATNYCFENLYLKDEKKSELGKHATKKEV
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaaatgtctgttccctgctgcaggctatggcacgcgctttcttccagctaca
aaatcaatgccaaaagaaatgatgccagtagtgaacaaaccgttgattgaatacggcgtt
gaagaggcaattcaagctggtatgaacggtatgtgtattgtgacaggccgtggcaaacac
tcaatcatggatcactttgataagaactacgagcttgagcaccaaattagcggtaccaac
aaagaagagttacttgtcgatattcgtgagatcattgaatcagcgaactttacctacatt
cgccaacgtgaaatgaaaggcctaggccacgcgattctaacgggtcgtgaactggttggt
gatgaacctttcgctgtagtacttgccgatgacttgtgtgtgaacgaggaagaaggcgtt
cttgctcaaatggttgctctgtttaagcaattccgctgttctatcgtggcagtacaagaa
gtacctgctgacgagacgcacaaatacggcgtgatttctggtgaaatgatcaaagatgac
atctaccgcgtagatgacatggtagaaaaaccagaaccaggcacagcgccaagcaatctt
gcgatcattggtcgttacatccttacccctgatatttttgaactgatcgaaaacacagaa
ccaggtaaaggtggtgaaatccaaattacggatgcgctgctgaaacaagcaaaagccggt
tgtgttctcgcatataaattcaaaggtaagcgctttgattgtggtagcgtagaaggctac
attgaagcaacaaactactgtttcgaaaacttgtacctaaaagatgaaaagaagtctgaa
ttaggtaagcacgcgacaaagaaagaagtgtaa

DBGET integrated database retrieval system