KEGG   Vibrio parahaemolyticus BB22OP: VPBB_2811Help
Entry
VPBB_2811         CDS       T02409                                 

Definition
Lysophospholipase L2
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
vpb  Vibrio parahaemolyticus BB22OP
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:vpb00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    VPBB_2811
Enzymes [BR:vpb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     VPBB_2811
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:3155433..3156443
Genome map
AA seq 336 aa AA seqDB search
MATNHSPLTYTQETLFEQAIGGPIAALWQTRQEGFVKGTEKKKIYWCKLTNPEHKKAVLI
VNGRIESSWKYQELFYDLYRQGYDVYSFDHRGQGLSDRLLSDSDMGHVYDFTDYIDDMDV
VIKQHDLKQYQQCFIIAHSMGGAIATRYLQTHPEHPFTGLILSAPMFGINLPWYLSPIAI
PVTQILSAVSPLPRYAPGHKPYFPKPFEDNPLSQSAGRYQWFRNLYTEKPELQVGGPSTR
WVWQGLMAAKQCFLLTRQVKVPVLLVQAGNDRIVSNLAQKRFIEKLRKTNPHAALLSIEG
AQHEILFETDQYRNQALDAIFRFMDDPTSSSDEKMQ
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atggctactaaccattcacctttgacttatactcaagagactttatttgagcaagcaatt
ggtggtccgatcgcagcactttggcaaactcgccaagagggctttgttaaagggacagag
aaaaagaaaatctactggtgcaaactcaccaaccctgaacacaaaaaagccgtgctgatc
gtcaatggccgcatcgaatcttcctggaagtaccaagagctgttttacgatctctaccgc
caaggttacgatgtgtattcctttgaccaccgaggacaaggtttatcagatcgcctatta
tctgactctgatatgggtcacgtctatgactttactgactatattgatgatatggacgtg
gtgatcaaacaacacgaccttaaacaatatcagcagtgctttatcatcgcgcactccatg
ggcggtgctatcgcgacgcgctatctgcaaacccacccagagcacccattcactggtttg
attttaagcgcccccatgtttggcattaacttgccgtggtacttatcgcctatcgctatc
ccagtgacgcaaattctttctgccgtgtcaccactgccgcgttatgcgccgggccacaag
ccgtactttcccaagccttttgaggacaatcctctcagccaaagcgcaggccgctaccag
tggtttcgcaatctctatacagaaaaaccggaactgcaagtcggcggaccaagcacgcgc
tgggtatggcaaggactcatggcagcgaaacagtgctttttgttaactcgccaagtaaaa
gtgcctgtgctactggttcaagcaggcaatgatcgtatcgtcagcaatctcgcacaaaaa
cgctttatcgagaagctacgtaaaaccaatcctcatgcggcattgctttctattgaaggc
gcacagcatgaaatcttgttcgaaacagaccagtaccgcaatcaagcgctcgatgcgatc
ttccgctttatggatgaccctacttcgtcgtcagacgaaaaaatgcaataa

DBGET integrated database retrieval system