KEGG   Vibrio parahaemolyticus BB22OP: VPBB_2826Help
Entry
VPBB_2826         CDS       T02409                                 

Definition
Uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
vpb  Vibrio parahaemolyticus BB22OP
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vpb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    VPBB_2826
Enzymes [BR:vpb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     VPBB_2826
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:3171841..3172569
Genome map
AA seq 242 aa AA seqDB search
MAVLVTRPGEQGCALCSLLERHGISAHHHPLIDIVADLTDTHLTTHLHQAQIVIAVSRHA
VQCAQQILTNNGASWPKQAVYLAVGQKTAHYLSKCTQQKVHYPEISDSEHLLRLPALQNV
EQQQVLILRGNGGRELIKDALVRRRAKVHYSETYKREFIPFDPVSCVSLWKTLQIDQIVV
TSGEQLDYLCSQLTSEQLTWLNQQELYIPSQRIADIAIQRGFTRVRCTGSASNQELLAAL
QP
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atggcagtgttggtcactcggccgggagagcaaggctgcgcgctttgctctctgctcgaa
aggcacggcatttccgcacaccaccatccgctgatcgacattgttgccgatctcacggac
acgcacctcacgactcatctccatcaagctcaaatagtaatcgccgttagccgacacgcc
gtgcaatgcgcccagcaaatcctaaccaacaatggcgcatcatggccgaaacaagcggta
taccttgccgttggtcaaaaaacagcacactatttaagcaaatgcacccaacagaaagta
cactatcccgaaatcagtgatagtgaacacttattgcgacttccagcgttacagaatgta
gaacagcagcaggttcttatccttcgtggtaacggaggaagagagctgatcaaagatgca
ttggtgagacgcagagcaaaagttcactatagtgagacttacaagagagaattcatccca
ttcgatccagtaagctgtgtctcactatggaaaaccctacaaattgaccagatcgtcgtc
accagtggtgaacaactggattatttgtgcagccaattgacgtcagagcaattgacttgg
cttaatcaacaagagttgtatatccccagccagcgcatcgctgacattgcaattcaaagg
gggttcactcgggtgaggtgcacaggaagcgcatccaaccaagaattactggctgctctc
cagccctag

DBGET integrated database retrieval system