KEGG   Vibrio parahaemolyticus BB22OP: VPBB_A0158Help
Entry
VPBB_A0158        CDS       T02409                                 

Definition
Agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
vpb  Vibrio parahaemolyticus BB22OP
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vpb00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    VPBB_A0158
Enzymes [BR:vpb01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     VPBB_A0158
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(164579..165499)
Genome map
AA seq 306 aa AA seqDB search
MNDLFTKTDYSLYSNSMSFLRLPYIRNPVSADADVVVLGVPLDMATSGRPGARMGPDAIR
RASVNLAWEGKKFPWDFNVLDKLKVIDAGDLVFDCGDAEDFTYRLEAATSEILKSGKTML
GLGGDHFITLPILRAYAKHHGQMALIHFDAHTDTYANGSSYDHGTMFYHAPKEGLISAKN
SVQIGIRTEYKQQDHGFNVINAMQANDMSVNEILEEIRRTVADKPVYVTFDIDCLDPAFA
PGTGTPVCGGLNSDKALKIIRGLAGMNIVGMDVVEVSPPYDHSDVTALAGATIALEMLYA
YASGRE
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgaatgatttgtttactaaaaccgattattcgctttactccaactctatgtcgttttta
cgtctaccgtacattcgtaatccggtatcggcagacgcagacgttgtggtgctaggggtt
cctctggacatggctacatctggtcgtccaggcgcacgcatgggtccagatgcaattcgc
cgtgcctcagtcaacttggcatgggaaggtaagaagttcccttgggacttcaacgtattg
gataaactgaaagtgatcgacgcgggcgaccttgtgttcgattgcggtgatgcggaagat
ttcacttaccgtctagaggcggcaaccagtgaaattctaaaaagcggcaaaaccatgttg
ggattgggcggtgaccacttcatcacactgcctatcctacgtgcttacgcaaagcatcat
ggccaaatggctttgattcactttgacgctcatacggatacctacgcaaatggcagttca
tacgaccacggtacgatgttctaccatgcgccgaaagaaggtttgatctcagcgaagaac
tcagtacaaatcggtattcgtactgagtacaaacagcaagatcacggcttcaatgtgatt
aatgcgatgcaagcgaatgacatgtcggtgaacgagatcttagaagagattcgtcgcacc
gtcgcagacaagccagtgtatgttacttttgacatcgactgcttggatccagcctttgca
ccgggaacaggtacaccagtttgtggtggcttgaactcagacaaagcgctgaaaattatt
cgtggattagccggcatgaatatcgtgggtatggatgttgtagaagtatcgcctccatac
gaccacagtgatgttaccgcactagcgggagcaaccattgcgctagaaatgctttacgca
tacgcatctggccgcgaataa

DBGET integrated database retrieval system