KEGG   Vibrio parahaemolyticus BB22OP: VPBB_A0158Help
Entry
VPBB_A0158        CDS       T02409                                 

Definition
Agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
vpb  Vibrio parahaemolyticus BB22OP
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:vpb00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(164579..165499)
Genome map
AA seq 306 aa AA seqDB search
MNDLFTKTDYSLYSNSMSFLRLPYIRNPVSADADVVVLGVPLDMATSGRPGARMGPDAIR
RASVNLAWEGKKFPWDFNVLDKLKVIDAGDLVFDCGDAEDFTYRLEAATSEILKSGKTML
GLGGDHFITLPILRAYAKHHGQMALIHFDAHTDTYANGSSYDHGTMFYHAPKEGLISAKN
SVQIGIRTEYKQQDHGFNVINAMQANDMSVNEILEEIRRTVADKPVYVTFDIDCLDPAFA
PGTGTPVCGGLNSDKALKIIRGLAGMNIVGMDVVEVSPPYDHSDVTALAGATIALEMLYA
YASGRE
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgaatgatttgtttactaaaaccgattattcgctttactccaactctatgtcgttttta
cgtctaccgtacattcgtaatccggtatcggcagacgcagacgttgtggtgctaggggtt
cctctggacatggctacatctggtcgtccaggcgcacgcatgggtccagatgcaattcgc
cgtgcctcagtcaacttggcatgggaaggtaagaagttcccttgggacttcaacgtattg
gataaactgaaagtgatcgacgcgggcgaccttgtgttcgattgcggtgatgcggaagat
ttcacttaccgtctagaggcggcaaccagtgaaattctaaaaagcggcaaaaccatgttg
ggattgggcggtgaccacttcatcacactgcctatcctacgtgcttacgcaaagcatcat
ggccaaatggctttgattcactttgacgctcatacggatacctacgcaaatggcagttca
tacgaccacggtacgatgttctaccatgcgccgaaagaaggtttgatctcagcgaagaac
tcagtacaaatcggtattcgtactgagtacaaacagcaagatcacggcttcaatgtgatt
aatgcgatgcaagcgaatgacatgtcggtgaacgagatcttagaagagattcgtcgcacc
gtcgcagacaagccagtgtatgttacttttgacatcgactgcttggatccagcctttgca
ccgggaacaggtacaccagtttgtggtggcttgaactcagacaaagcgctgaaaattatt
cgtggattagccggcatgaatatcgtgggtatggatgttgtagaagtatcgcctccatac
gaccacagtgatgttaccgcactagcgggagcaaccattgcgctagaaatgctttacgca
tacgcatctggccgcgaataa

DBGET integrated database retrieval system