KEGG   Vibrio parahaemolyticus BB22OP: VPBB_A0169Help
Entry
VPBB_A0169        CDS       T02409                                 

Definition
6-phospho-beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
vpb  Vibrio parahaemolyticus BB22OP
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:vpb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VPBB_A0169
Enzymes [BR:vpb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     VPBB_A0169
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(176535..177926)
Genome map
AA seq 463 aa AA seqDB search
MIKFPDNFLWGGAIAANQVEGAYNLGGKGLSTSDMLPNGILSPHQTREERTPGIKDLAID
FYNRYPEDIALFKEMGFTCLRLSIAWSRIFPNGDELEPNEEGLAFYDKIFDELAKHDMQP
FVTLSHYEMPYALVENYGGWGDRRVIEFFERYAKIVLERYKDKVKLWLTFNEINMSLHAP
FTGVGLPEDATEQQIYQAIHHQLVANAKAVKLCQKIVPNGKIGNMLLGAMNYPYTCNPDD
VLAAMHENNKWLFFGDVQTRGQYPGYMKRYFRENGIEIQMEDGDLEDIASASVDFISFSY
YASGCASADPKQKEVGNIVESVPNPYLEKSQWGWLIDPKGLRILLNFLHDRYQKPLFIVE
NGLGARDEFDENGEIQDDYRIAYLNDHLVQAHEAILDGVELMGFTSWGPIDLVANSTAEM
SKRYGYIYVDRHDDGQGTLERKRKKSFYWYQDVIRTAGGSLKR
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgattaagtttccagataatttcctttggggtggtgccattgctgcaaaccaagtagag
ggggcatacaaccttgggggtaaaggtttatcaacatcagatatgttgccaaacggcatt
ctgagcccgcatcaaacgcgtgaagaacgaacaccaggtatcaaagatcttgcgatcgat
ttctacaatcgctatccagaagatattgctctatttaaagagatgggattcacctgcctg
cgcttgtccatcgcttggagtcgtatttttcctaatggcgatgaactggagccaaacgaa
gaaggactggcgttttacgacaaaatttttgatgagctagccaaacacgacatgcaacca
tttgtgacgctttctcattacgagatgccttacgccttggttgagaattatggtggttgg
ggcgatcgtcgagtgatcgagtttttcgagcgttacgctaaaatcgtgttagaacgctac
aaagataaggtcaaactgtggcttaccttcaacgaaatcaacatgtctctgcatgcacca
tttactggggttggtttgccagaagacgcaacagagcaacagatttaccaagcgattcac
catcaattggtggcgaatgctaaagcagtgaagctgtgccagaaaattgtaccgaatggc
aaaatcggcaacatgttactgggtgccatgaactacccatacacttgtaaccctgatgat
gtgctagccgccatgcatgaaaacaacaagtggttgttcttcggtgatgtgcaaactcgt
ggtcagtatcctggttatatgaagcgctatttccgtgaaaatggcatcgagatccagatg
gaagacggcgatttagaagacatcgcctcggccagtgtcgactttatctcctttagctac
tacgccagtggctgtgcgagcgcagatccgaaacagaaggaagtcggcaatattgttgag
agcgtgccaaatccatatttggaaaagagccaatggggctggttgatcgatcccaaaggt
ctgcgtattttgctgaacttcttgcacgatcgctaccaaaagccgctctttatcgtggaa
aatggtttgggagcgagagatgaatttgacgaaaatggcgaaattcaagatgactaccgc
atagcctacctcaacgatcacctagtgcaagcgcacgaagccattcttgatggcgttgaa
ttaatgggtttcaccagttgggggccgattgatttagtagccaactcaacggcagaaatg
agcaagcgttacggatatatctacgttgatcgtcacgatgatggacaaggcactttagaa
cgtaaacgcaaaaagagcttctactggtatcaggatgtgattcgtaccgcaggtggttcg
ttaaaacgctaa

DBGET integrated database retrieval system