KEGG   Vibrio parahaemolyticus BB22OP: VPBB_A0186Help
Entry
VPBB_A0186        CDS       T02409                                 

Definition
GGDEF family protein
Orthology
K13590  
diguanylate cyclase
Organism
vpb  Vibrio parahaemolyticus BB22OP
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(203034..204047)
Genome map
AA seq 337 aa AA seqDB search
MTDEFKKSTANLKKAVPLMIKNHVAATPANYALWYTYVDKTIPELNFEMDEVLEHYGICP
PAANKQLYNNYVASRAETSLEDLKTNVEVLLHEVSSSMSDTLSDTSSFSAMVDKSFNKLE
KVEDNSLSIEEVMVVIRQLVAESHEIRHSTKFLNRQLTNASEEISRLKNQLAEVQKDALF
DGLSNLYNRRAFDTDLSMLINANQAMTLILLDIDHFKAFNDNYGHLFGDTVLKAIARRLQ
QSCRDGVSAYRFGGEEFALIVPNKSLRIARQYADTLRRMIEKLRVRDKRSGTQVHSITAS
FGVAEFEVGDTVDSLVNKADKQLYEAKQLGRNRVMPI
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgactgacgagtttaagaaatcgaccgctaacttaaaaaaagcggtgccactaatgatc
aaaaatcatgtagctgccacccccgcaaactacgcgctttggtatacctacgtagacaaa
accattccagaactcaattttgagatggacgaagtgttagaacactacggtatttgtcca
ccagcagcgaacaaacagctttacaacaactacgtggccagtagagcagaaaccagttta
gaagatctcaaaaccaacgtagaagtactattacatgaagtgtcgagctccatgagtgat
actttgtcagatacctcttctttctctgcgatggtcgataagagcttcaacaaattagaa
aaagttgaagacaacagcttgagcatcgaagaagtgatggtggtgatccgccaactcgtt
gctgaatctcatgagattcgccactcaactaaattcttaaaccgtcaactcaccaatgcg
agtgaagaaatttctcgtttgaagaatcaattagccgaagtacaaaaagacgcgctgttt
gatggactctctaatctttacaatcgtcgtgcctttgatactgatttgagcatgctgatt
aacgctaatcaggcgatgactctcatcttgctggatatcgaccactttaaagcgtttaac
gataactatgggcacctatttggtgacactgtattgaaagcgatcgcgcgtcgactgcaa
caaagctgtcgcgatggcgtgagtgcataccgcttcggcggcgaagaatttgcgttaatt
gtgccaaacaaatccctacgaatcgcccgccaatatgcagataccctacgccgcatgatt
gaaaagctgcgcgtacgtgataaacgctcgggcacacaagttcatagcattaccgcttct
tttggtgtggcagagttcgaagttggtgacaccgtagattcattagtcaacaaagccgat
aaacagctttatgaagcaaaacaactcggtcgaaaccgagtgatgcctatctaa

DBGET integrated database retrieval system