KEGG   Vibrio parahaemolyticus BB22OP: VPBB_A0287Help
Entry
VPBB_A0287        CDS       T02409                                 

Definition
Nicotinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
vpb  Vibrio parahaemolyticus BB22OP
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vpb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    VPBB_A0287
Enzymes [BR:vpb01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     VPBB_A0287
    3.5.1.-  
     VPBB_A0287
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(307992..308645)
Genome map
AA seq 217 aa AA seqDB search
MTVRVNYQTTAVIDVDPEKGFSELCPDELPVAGALDIVPELLKNHAKGRLKLVSRDLHPP
KAAWDAETPANMLEPVGLPNVDVKWNRHCVLGTTGVELLDGLPPVLDYDFQVNKGMDPDA
HPYGIFFHDVADTKTTGANEFLKCNKIDTVVVGGLALDFCVKKSVMQALDLGFKVIVNLA
ATRAVLPDTVDSVIAEMKEKGAQFVKNADDIIVERFA
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgactgttcgagttaactatcaaactacagccgtgatcgacgttgatccagagaaaggc
tttagtgagctttgtccagatgaattacctgtagcaggcgcattggacatcgtgccggag
ctactaaaaaaccatgcgaaaggtcgcttgaagctagtaagccgtgacttgcacccaccg
aaagccgcttgggatgcagaaacgcccgcgaacatgctagagcctgttggcttgccaaat
gtcgacgtaaaatggaatcgccactgtgtgcttggcacaacaggcgtagagcttctggat
ggattacctccagtgcttgactacgatttccaagttaataaagggatggatccggacgca
cacccttacggcatcttcttccatgacgtggctgacaccaaaactacgggtgcaaatgag
tttctgaaatgcaataaaatagataccgtcgtagttggtggattagcgctcgatttctgc
gtcaagaaatccgttatgcaagcgttagatctcggctttaaggtgattgtgaatctggct
gcaactcgcgccgttctgccagatacggtcgacagcgtgatcgcagagatgaaagaaaaa
ggcgcacagtttgttaaaaatgccgatgacattattgttgaacgcttcgcgtaa

DBGET integrated database retrieval system