KEGG   Vibrio parahaemolyticus BB22OP: VPBB_A0287Help
Entry
VPBB_A0287        CDS       T02409                                 

Definition
Nicotinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
vpb  Vibrio parahaemolyticus BB22OP
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:vpb00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(307992..308645)
Genome map
AA seq 217 aa AA seqDB search
MTVRVNYQTTAVIDVDPEKGFSELCPDELPVAGALDIVPELLKNHAKGRLKLVSRDLHPP
KAAWDAETPANMLEPVGLPNVDVKWNRHCVLGTTGVELLDGLPPVLDYDFQVNKGMDPDA
HPYGIFFHDVADTKTTGANEFLKCNKIDTVVVGGLALDFCVKKSVMQALDLGFKVIVNLA
ATRAVLPDTVDSVIAEMKEKGAQFVKNADDIIVERFA
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgactgttcgagttaactatcaaactacagccgtgatcgacgttgatccagagaaaggc
tttagtgagctttgtccagatgaattacctgtagcaggcgcattggacatcgtgccggag
ctactaaaaaaccatgcgaaaggtcgcttgaagctagtaagccgtgacttgcacccaccg
aaagccgcttgggatgcagaaacgcccgcgaacatgctagagcctgttggcttgccaaat
gtcgacgtaaaatggaatcgccactgtgtgcttggcacaacaggcgtagagcttctggat
ggattacctccagtgcttgactacgatttccaagttaataaagggatggatccggacgca
cacccttacggcatcttcttccatgacgtggctgacaccaaaactacgggtgcaaatgag
tttctgaaatgcaataaaatagataccgtcgtagttggtggattagcgctcgatttctgc
gtcaagaaatccgttatgcaagcgttagatctcggctttaaggtgattgtgaatctggct
gcaactcgcgccgttctgccagatacggtcgacagcgtgatcgcagagatgaaagaaaaa
ggcgcacagtttgttaaaaatgccgatgacattattgttgaacgcttcgcgtaa

DBGET integrated database retrieval system