KEGG   Vibrio parahaemolyticus BB22OP: VPBB_A0593Help
Entry
VPBB_A0593        CDS       T02409                                 

Definition
Dihydrolipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
vpb  Vibrio parahaemolyticus BB22OP
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:vpb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    VPBB_A0593
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VPBB_A0593
   00020 Citrate cycle (TCA cycle)
    VPBB_A0593
   00620 Pyruvate metabolism
    VPBB_A0593
Enzymes [BR:vpb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     VPBB_A0593
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(640864..642018)
Genome map
AA seq 384 aa AA seqDB search
MKTFNLPDLGEGLAESEIVKWHVNVGDMVKLDQVILTVETAKATVDVPAPYAGRIVSRHG
EEGDVINIGALLLEIDESGAENTVSAEKRQTADAATVVGTVSHQSHNVNVDDFWVGGSHN
KSADKLITALPSARLLAKKLGVDLKTMVGSGPSGLIVDADVYEEAGKQVPGTEVLKGARR
TMVSTMAESHQSVAAVTITEEALLEDWLPNEDISIRLVQAIVYACQQEPALNAWFDAETM
TRCVHPTVNLGVAVDSRHGLYVPVLRHADEYEPQDVRRWLDQTVKGIRDRKISREDLQHA
TITLSNFGAIGGIFATPVVSPPQVAIVGAGRIVDRVVIRNGQAVTVQAMPLSITFDHRAC
TGGEAARFTKVLAEHLQRPSVTKS
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgaagacgtttaacttacccgatctcggcgaaggtctcgctgagtcagaaattgtaaaa
tggcatgtcaatgtgggtgacatggtcaaactcgatcaagtgatcctcaccgttgagacg
gcgaaagcaaccgtagacgttccagctccgtacgcaggcagaattgtcagccgccatggt
gaagaaggcgacgtgattaatattggcgccctacttctagaaatcgacgaaagtggcgca
gaaaacactgtctctgcggaaaaacgacaaactgccgatgccgcaaccgttgttggcacc
gtatctcaccaatctcataacgtaaatgttgatgatttttgggtgggcggcagccacaac
aaatcggcagacaaactcatcaccgccttaccttccgcgcgtttgctagcgaaaaaacta
ggcgtagatttgaaaacgatggtcggtagcggaccaagcggtttgatcgtcgatgccgat
gtttacgaagaagcaggcaaacaagttcctggcactgaagtgctcaaaggagcgcgacgt
acgatggtctcgaccatggcagaatcgcatcaaagtgtcgcagcggtgaccattaccgaa
gaagcgttattggaagattggttgccaaacgaggacatcagcattcgtctggtacaagct
atcgtttatgcttgccagcaagagccagctctcaacgcttggttcgatgccgaaaccatg
acgcgctgtgttcatcctaccgtcaatcttggtgtagcggtggacagccgtcacggactg
tatgtccccgtgcttcgccacgcggatgagtatgaaccgcaagacgttcgtcgctggctc
gatcaaaccgtcaaaggcatccgagacagaaagatcagccgagaagacttacaacacgca
accattactttgtccaactttggggccattggcggcattttcgcaacaccagtggtttca
ccaccgcaagtcgcgattgtcggtgcaggacgaattgtggaccgagtcgtgatccgtaac
ggtcaagccgtaaccgtgcaagcgatgccgttatccatcacctttgaccacagagcttgt
accggcggtgaagccgcgcgctttaccaaggtgcttgcagaacatctgcaaaggccaagt
gtaactaagtcataa

DBGET integrated database retrieval system