KEGG   Vibrio parahaemolyticus BB22OP: VPBB_A0651Help
Entry
VPBB_A0651        CDS       T02409                                 

Definition
Fatty acid desaturase Delta-9 fatty acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
vpb  Vibrio parahaemolyticus BB22OP
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:vpb00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    VPBB_A0651
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    VPBB_A0651
Enzymes [BR:vpb01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     VPBB_A0651
Lipid biosynthesis proteins [BR:vpb01004]
 Desaturase
  First
   VPBB_A0651
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(721835..722959)
Genome map
AA seq 374 aa AA seqDB search
MNQNKPPFIWLNILIFSASFVLTFIVMPWYAYHYGLGWEHLIWGILAFSFTNLSITAGYH
RLWSHKTYEAHPVLRAIFAIGGAFSLQNSALHWSSDHRVHHKHVDNNDKDPYSAKRGFWY
SHIGWMLRDYNKSKENEYTNCRDLKRDSIVMWQHNYYVPLALLTNIGFPVALGLIYGDVW
GMLLVVGAARLFLSHHTTFFINSLAHVWGKQTFTDKNTARDNGVLAFFTFGEGYHNFHHI
FENDYRNGVYWWHYDPTKWLIKSCSWLGLTSKLRTTSTFRIEKARATQLLKKAKEKLESK
PNAQTVLDQLQQEFDALVHHMQEYYEARKELLGEKTANVVKKYECSVSKLKYQQLKTEFE
RQQRSWNLMIRRYA
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
gtgaatcaaaacaaaccaccatttatctggttgaatatattgattttttcagccagtttt
gttctaacgtttattgtaatgccttggtacgcatatcattatggactgggctgggagcac
ttgatttggggtatccttgcattcagtttcactaacctgtcgattactgcgggatatcat
cgcctttggagccataaaacttacgaagctcatcctgtattacgtgcaattttcgcgatt
ggcggcgctttttctctccaaaacagtgcattacactggtcttctgatcaccgagtgcat
cacaaacatgtcgataacaatgacaaagatccctactccgccaaacgtggcttttggtat
tcacacattggctggatgttgcgcgactacaataagtctaaagaaaatgagtacaccaat
tgccgcgatctaaaacgcgatagcattgtgatgtggcaacacaactactacgtgccgtta
gctttgctgactaatatcggtttccccgtagctttaggtcttatctatggggatgtttgg
ggaatgctgctggttgttggcgcagctcgcctgttcttgagccatcacacaaccttcttt
attaactctttggcgcatgtttggggcaagcaaacttttacggacaaaaatacggcccgc
gataacggtgtcttagccttctttacctttggcgagggttaccacaattttcaccacatc
tttgagaatgactaccgcaatggtgtttattggtggcactacgatccaactaaatggctg
atcaagtcttgttcttggttggggctgacgtccaagcttcgcactacatcaactttccga
attgaaaaagcgcgagcaacccagttgttgaagaaagcgaaagagaaactggagtccaaa
cccaatgcgcaaacagttctcgatcaacttcagcaagagtttgatgcattggttcaccat
atgcaggaatactacgaagcgcgcaaagagttgctcggtgagaaaactgcgaacgtagta
aagaaatacgagtgctctgtatcgaaattgaagtatcaacaacttaaaactgagtttgag
cgtcaacaacgtagttggaacttgatgatccgtcgttacgcataa

DBGET integrated database retrieval system