KEGG   Vibrio parahaemolyticus BB22OP: VPBB_A0729Help
Entry
VPBB_A0729        CDS       T02409                                 

Definition
Phospholipase A1 precursor
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
vpb  Vibrio parahaemolyticus BB22OP
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vpb00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    VPBB_A0729
   00565 Ether lipid metabolism
    VPBB_A0729
   00590 Arachidonic acid metabolism
    VPBB_A0729
   00591 Linoleic acid metabolism
    VPBB_A0729
   00592 alpha-Linolenic acid metabolism
    VPBB_A0729
Enzymes [BR:vpb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     VPBB_A0729
    3.1.1.32  phospholipase A1
     VPBB_A0729
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:805144..806172
Genome map
AA seq 342 aa AA seqDB search
MASKATGISILSLLVAPVAMGETASAYDLCLLETIKKSNGEETIESIRKQCELDTVTSTA
SVESTTKESEEPQESLIDKRLESEKQTAFEPFSLVAHRINYILPFTYSDRVNKRAYADTK
YGDELRKEEAEFQISFKVPMNYDDLLFDGDGLFFGMTLKSFWQVYTGDASRPFRETNYRP
ELFYFTPTSWQPLGGSTWLGFGIEHESNGQRQELSRSWNRVYTNLTFAKDNFVASIQPWW
RIPEDEKTFPNDPKGDDNPDIEDYMGHFELTSAYKWDDYELTFLGRENFKTHKGYAEIGL
LFPIWGKVRGYAQYSTGYGKSLIDYDHNQQRIGVGIAINGVL
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atggcttcaaaagcgacagggatatcgatactgagtttattagtagctccggtggcgatg
ggagagaccgcaagcgcatacgatttatgtttgctagaaacaatcaaaaaaagcaatggc
gaagaaacgatcgagagcattcgcaagcagtgtgagttagataccgtcacgagcactgcg
tctgtcgaatcaacaacgaaagaatcagaagaaccgcaagaaagcttgatcgataaacgt
ttggagtcagaaaagcaaaccgcgttcgagccttttagcctggttgcacatcgaattaac
tacattcttccgtttacttatagtgatcgcgtaaacaaacgtgcgtatgccgacaccaaa
tacggcgatgaactgcgtaaggaagaggcagagtttcaaatcagctttaaagtaccaatg
aactacgacgatttgttgtttgacggcgatggcctgttttttggtatgacgctcaaatcg
ttctggcaggtatacacgggggatgcgtcgcgtccgtttcgcgaaaccaattatcgtcct
gagctgttttacttcacccctacaagttggcagccgcttggtggctcaacttggctgggt
tttggtattgaacatgaatcaaatggccaaagacaagagctatcgcgcagttggaaccgc
gtttataccaacttaacctttgcgaaagacaattttgtcgcctctatccaaccttggtgg
cgcatacctgaggacgaaaaaacctttccgaatgatcctaaaggcgatgataacccagat
atcgaagattacatggggcattttgagctaacaagcgcctacaaatgggacgattacgag
ttgacgttcttggggcgcgagaactttaaaactcataaaggctatgctgagataggtttg
ttgtttccaatttggggaaaagttaggggatatgctcaatactcgactggatacggcaag
agcttaattgactacgaccataatcagcagcgcattggtgttggtatcgcgatcaacggt
gttctgtag

DBGET integrated database retrieval system