KEGG   Vibrio parahaemolyticus BB22OP: VPBB_A0819Help
Entry
VPBB_A0819        CDS       T02409                                 

Definition
Arylesterase precursor
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
vpb  Vibrio parahaemolyticus BB22OP
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:vpb00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    VPBB_A0819
Enzymes [BR:vpb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     VPBB_A0819
   3.1.2  Thioester hydrolases
    3.1.2.-  
     VPBB_A0819
Lipid biosynthesis proteins [BR:vpb01004]
 Fatty acid synthase
  Component type
   VPBB_A0819
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(912100..912702)
Genome map
AA seq 200 aa AA seqDB search
MIRLLSLVLFFCLSAVSQASEKLLVLGDSLSAGYQMPIEKSWPSLLPDALLEHGQDVTVI
NGSISGDTTGNGLARLPQLLDQHTPDLVLIELGANDGLRGFPPKVITSNLSKMISMIKDS
GANVVMMQIRVPPNYGKRYSDMFYDIYPKLAEHQQVQLMPFFLEHVITKPEWMMDDGLHP
KPEAQPWIAEFVAQELVKHL
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgattcgtttactttccttagttctctttttttgtctttccgccgtatcgcaagcaagc
gaaaagcttcttgttcttggtgatagcttgagtgccggctatcaaatgccgattgagaag
agttggcctagcttactccctgacgcgctgctcgaacacgggcaagatgtaacagttatt
aatggcagcatctccggagacactactggcaacggtttggctcgcctcccgcaactgctt
gaccaacatacacccgacttagttcttatcgagttgggcgccaatgatgggttgcgtggt
tttcctcccaaagttattacgtcgaatctgtcgaaaatgattagcatgatcaaagattct
ggtgccaatgtggtcatgatgcaaattcgtgtcccacctaactacggcaagcgctacagc
gacatgttttacgacatctatcccaaattggctgaacatcaacaagttcagttaatgccg
ttcttcttagagcatgtgatcaccaaaccagagtggatgatggatgatggcttacatccg
aaacctgaagctcaaccttggattgcggaattcgttgctcaagaattggttaaacatctc
taa

DBGET integrated database retrieval system