KEGG   Vibrio parahaemolyticus BB22OP: VPBB_A0987Help
Entry
VPBB_A0987        CDS       T02409                                 

Definition
Ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
vpb  Vibrio parahaemolyticus BB22OP
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:vpb00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    VPBB_A0987
Enzymes [BR:vpb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     VPBB_A0987
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(1111194..1112111)
Genome map
AA seq 305 aa AA seqDB search
MNKLVVLGSVNADHVLQVPSFPRPGETLHGRNYQVIPGGKGANQAVAAARLNADIGFIAC
VGDDSFGINIRENFKMDGIDITGVKMQPNCPTGIAMIQVSDSGENSICISAEANAKLTSE
AIEPDLERIRQADYLLMQLETPMCGIEKAARVAKDAKTNVILNPAPARELPDELLACIDV
ITPNETEAEVLTGVTVTDNESAQEAANVLHGKGIEIVMITLGAKGVWLSQNGRGEIIPGF
RVEATDTTAAGDTFNGAFVTGLLEDLPLESAIKFAHAAAAISVTRFGAQTSIPTREEVDA
FLAEQ
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgaataagttagtggtgttaggtagtgtaaacgctgaccatgttcttcaagtgccttct
ttccctcgccctggcgagacgctgcatggtcgcaactatcaagttatcccaggtggcaaa
ggtgccaaccaagccgtcgcggcggcgcgattaaatgcagacattggttttattgcttgt
gtaggcgatgactctttcggcatcaacattcgtgaaaacttcaaaatggacggcatcgat
atcactggtgttaagatgcaaccaaactgcccgacaggcatcgcgatgattcaagtgtcg
gacagtggtgaaaacagcatttgtatatcagcagaagcaaacgccaaactcacatcagaa
gcgattgagccagatttagaacgtattcgccaagcggattacttgctaatgcaattggaa
acgccgatgtgcggcattgagaaagccgcgcgtgtggcaaaagatgcaaaaaccaacgta
attttaaacccagctccagctcgtgaattgccagatgaactacttgcttgtattgacgtg
atcacgccaaatgaaacggaagctgaagtgctgacaggtgttactgtaacagacaacgaa
agcgcgcaagaagcggcgaatgtgctacatggtaaaggtattgaaattgtcatgatcact
ctcggtgcaaaaggtgtttggttgagccaaaatggccgaggtgaaattatccccggtttc
cgtgtcgaagcgaccgataccaccgcggcaggtgatacgtttaatggggcattcgtcact
ggtctcttagaagatttacctttagaatcagcgattaagtttgcacatgcggcggctgca
atttctgtgacccgctttggcgcgcaaacgtcgatcccaactcgcgaagaggtggacgcg
tttctcgctgaacaataa

DBGET integrated database retrieval system